KEGG   Bordetella bronchiseptica MO149: BN115_1526Help
Entry
BN115_1526        CDS       T02295                                 

Gene name
accC
Definition
(GenBank) biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm00061  Fatty acid biosynthesis
bbm00620  Pyruvate metabolism
bbm00640  Propanoate metabolism
bbm01100  Metabolic pathways
bbm01110  Biosynthesis of secondary metabolites
bbm01120  Microbial metabolism in diverse environments
bbm01130  Biosynthesis of antibiotics
bbm01200  Carbon metabolism
bbm01212  Fatty acid metabolism
Module
bbm_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN115_1526 (accC)
   00640 Propanoate metabolism
    BN115_1526 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BN115_1526 (accC)
Enzymes [BR:bbm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BN115_1526 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BN115_1526 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATP-grasp_5 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CCJ58282
LinkDB All DBs
Position
1645380..1646750
Genome map
AA seq 456 aa AA seqDB search
MKLKKVLIANRGEIALRIIRACREMDIRTVQVYSSADEDSLPVRLADEAVPIGGPEPSAS
YLNIAALIAAAREHGCDAIHPGYGFLSENEDFAQACIDAGIVFIGPDPGAIRMMGDKAQA
RKIAKEAGVPIVPGSPEPVSDVEEAIRVAREVGYPLLVKAAAGGGGRGMRVIQGEAQLRE
GLERASMEAKSAFGDGSVYIERYISPVRHVEIQVFGDGEDVIHLGERECSIQRRHQKLLE
ESPSPVLSDETRQRMGEAACALARAVKYRGAGTLEFVMDGKSGEFFFIEMNTRIQVEHPV
TETVTGVDLVRLQLAVAAGGRLGLRQQDIVMKGHAIECRINAEDPQKAFMPSPGTVNDIR
LPSGPGVRMDSHVYRGYKLPPYYDSLLGKLIVWDESREKAIARMLRALGELEIVGVKTTK
EFHERLMRDEDFIAGNVSTQFVKEKLYADHPMRHLL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaaaaggtattgattgcgaacaggggagagatcgccctgcgtatcatccgc
gcgtgccgggagatggacatacggaccgtccaggtctactccagcgcggatgaggattca
ttgcctgtcaggttggccgatgaagcggtccccatcggcggccccgagccgtcggcaagc
tacctgaacatcgcggcgctgatcgccgccgcgcgcgagcatggctgcgacgccatccat
cccggctacggcttcctgtccgagaacgaagacttcgcccaggcctgcatcgacgccggc
atcgtcttcatcggcccggaccccggcgcgatccgcatgatgggcgacaaggcgcaggcc
cgcaagatcgccaaggaggcgggcgtgcccatcgtgccgggctcgcccgagccggtcagc
gacgtcgaggaggccatcagggtggcccgcgaggtcggctatccgttgctggtcaaggcg
gcggcgggcggcggcgggcgcggcatgcgcgtgatccagggcgaggcgcagctgcgcgag
gggttggagcgcgcgtcgatggaggccaagtcggccttcggcgacggctccgtctatatc
gaacgctatatctcgcccgtgcgccacgtcgagatccaggtgttcggcgatggcgaggac
gtcatccacctgggcgagcgggaatgctcgatccagcgccgccaccagaagctgctggag
gaaagcccgtcgccggtgctgtccgacgaaacgcggcagcgcatgggcgaggcggcctgc
gcgctggcgcgcgcggtcaagtatcgcggcgcgggaacgctggagttcgtcatggacggc
aagagcggcgaattcttcttcatcgaaatgaatacgcgcatccaggtcgagcaccccgtc
acggaaaccgtcacgggcgtggacctggtcaggctccagctggcggtggccgccggcggc
aggctgggcctgcgccagcaggacatcgtcatgaaggggcacgcgatcgaatgccgcatc
aacgcggaggatccgcagaaggcgttcatgcccagcccgggcacggtcaacgatatccgg
ctgccttcggggccgggcgtgcgcatggattcgcacgtgtaccgcggctacaagctgccg
ccgtactacgactcgctgctgggcaagctgatcgtctgggacgagtcgcgcgagaaagcc
atcgcccgcatgctgcgcgcgctgggcgaactggagatcgtcggcgtgaagacgaccaag
gaattccacgaacggctcatgcgagacgaggatttcatcgccggcaatgtcagcacccag
ttcgtcaaggaaaagctgtacgccgaccaccccatgcgccatttgctctga

DBGET integrated database retrieval system