KEGG   Bordetella bronchiseptica MO149: BN115_1558Help
Entry
BN115_1558        CDS       T02295                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase/fumarate reductase,flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm00020  Citrate cycle (TCA cycle)
bbm00190  Oxidative phosphorylation
bbm00650  Butanoate metabolism
bbm01100  Metabolic pathways
bbm01110  Biosynthesis of secondary metabolites
bbm01120  Microbial metabolism in diverse environments
bbm01130  Biosynthesis of antibiotics
bbm01200  Carbon metabolism
Module
bbm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bbm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN115_1558 (sdhA)
   00650 Butanoate metabolism
    BN115_1558 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BN115_1558 (sdhA)
Enzymes [BR:bbm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BN115_1558 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BN115_1558 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like AlaDh_PNT_C FAD_oxidored Pyr_redox Caps_synth
Motif
Other DBs
NCBI-ProteinID: CCJ58314
LinkDB All DBs
Position
complement(1677978..>1679591)
Genome map
AA seq 537 aa AA seqDB search
VAETDTDVLVLGGGIAGYRAAAAARAAGARVTLAYRGRGASPYVIGFNAPLGHAGEDDPQ
TYFDDMVRGGYGLNDRRLVTRLAHEANTAYAELDALGVPFARAADGRRVLQRHLSGNTHA
RSVYVPQGTGRAVLDALIRQARDLGIVERGGEKIIGLAHDGAGVAGALLWKPHTTELALV
RARAVIVAMGGLGQLYGGSTYPVDVAADAFAMAHEAGARLIDMEFVQFEPVVTVWPQACA
GMEMPTAMLGDGAQLRNAAGERFMLRYNPPHAERQIEKARMALCIQQEIDAGRGLPEGGV
WFDATLLPTDKLESYVSHCARLRAAGVDPGRQAVVVAPAAHSAMGGIDIDACGWTGVPGL
YAAGEAAGGVHGASRIAGNGCSDTLVLGALAGRHAAAAPATQARAGLAETALYDLRRWHG
ADRGDPAPLRQAIQATLAEHAGIWRHAAGLRAAGARLAQVQAQLRGMRAATLPGALALLQ
TERMARCAAMVVAAALTRTESRGAHQRRDFPQQDPRWLAHLAFQRDRGAAPFIAPIH
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gttgccgaaaccgataccgatgtcctggtgctgggcggcggcatcgccggctaccgtgcc
gcggcggcggcccgcgcggccggcgcacgggtgacgttggcctatcgcggacgcggcgcc
tcaccctacgtgatcggcttcaacgccccgctgggccatgccggcgaggacgatccgcaa
acttacttcgacgatatggtgcgcggcggctatgggctgaacgaccggcggctggtgacg
cgcctcgcccacgaagccaataccgcctatgccgagctcgacgcgctgggcgtgcccttc
gcccgcgccgccgacggccgccgcgtcctgcagcgccacctgtcgggcaatacccatgcg
cggtcggtctatgtgccgcagggcaccggacgggcggtgctggacgcgctgatacgccag
gcccgcgatcttggcatcgtcgaacgcggcggcgaaaaaatcatcggcctggcccacgac
ggcgccggagtggccggcgccctgctctggaaaccgcacaccacggagcttgccctggtg
cgcgcgcgcgccgtcatcgtcgccatgggcggcctgggccagctgtatggcggcagcacc
tatcccgtcgacgtagcggccgacgcgttcgccatggcccacgaggccggcgccaggctg
atcgatatggagttcgtgcaattcgagccggtggtcaccgtatggccgcaagcgtgcgcc
ggcatggaaatgccgaccgccatgctgggcgacggcgcgcaactgcgcaacgccgccggc
gagcgcttcatgctgcgctacaacccgccgcacgccgaacggcagatcgagaaggcccgc
atggcgctgtgcatccagcaggagatcgacgccgggcgcggcctgcccgaaggcggcgtg
tggttcgacgccacgctgctgccgaccgacaagctggaaagctatgtatcgcactgcgcg
cggctgcgtgccgccggcgtggacccggggcgtcaggccgtcgtggtcgcgcccgcggcg
cacagcgccatgggcggcatcgacatcgacgcgtgcggctggaccggcgtgccgggcttg
tacgccgccggcgaggccgccggcggcgtacatggcgccagccgcatcgccggcaacggc
tgcagcgacacgctggtgctgggcgcgctggccgggcgccatgccgccgccgcaccggcc
acgcaggcacgcgccggcctggccgagaccgccctgtatgacctgcgccgctggcacggc
gcggaccggggcgacccggccccgctcaggcaagcgatacaggccacgctggccgaacac
gccggcatctggcgccacgccgccggcctgcgcgccgccggcgcgcgcctggctcaggtg
caggcgcagttgcgcggcatgcgcgcggccaccctgcccggcgcgctggccttgctgcag
accgaacgcatggcgcgctgcgccgcgatggtggtggccgcggcgctgacgcgcaccgaa
agccgcggcgcacaccagcgccgcgacttcccgcagcaggacccacgctggctggcgcac
ctggccttccagcgcgaccgcggagccgcccctttcatcgccccgattcactga

DBGET integrated database retrieval system