KEGG   Bordetella bronchiseptica MO149: BN115_3878Help
Entry
BN115_3878        CDS       T02295                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm00473  D-Alanine metabolism
bbm00550  Peptidoglycan biosynthesis
bbm01100  Metabolic pathways
bbm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bbm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BN115_3878 (ddlB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN115_3878 (ddlB)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BN115_3878 (ddlB)
Enzymes [BR:bbm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BN115_3878 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:bbm01011]
 Precursor biosynthesis
  Amino acid ligase
   BN115_3878 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp TTL ATPgrasp_ST ATP-grasp_4 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: CCJ60634
LinkDB All DBs
Position
complement(4242566..4243516)
Genome map
AA seq 316 aa AA seqDB search
MSKQFGKVGVLYGGRSAEREVSLMSGKGVHEALLSAGVDAHLFDTGERSLADLAAAGFER
VFIALHGRYGEDGTLQGALELLGIPYTGSGPLASSLSMDKIMTKRVWLQHGLPTPAFEVL
GGSTELRLVPDRLGLPLILKPPHEGSTVGITKVAGYSDMKAAYELAARFDAEVLAEQFIT
GRELTVAVLGSGAAARALPVIEIVAPGGNYDYEHKYFSDDTQYFCPADLPADVAADVAAV
AERAYAALGCEGWGRVDFILDRENRPWLLEMNTSPGMTGHSLVPMAARAVGMSYADLCVA
ILAEAACKVRSPARQD
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcaattcggcaaagtcggcgtgttgtacggcggccgttcggccgagcgggaa
gtgtcgctgatgtccggcaagggcgtgcacgaagccctgctgagcgccggcgtggacgcg
cacctgttcgacaccggcgagcgcagcctggcggacctcgccgcggcgggtttcgagcgc
gtgttcatcgccctgcatggccgctatggcgaggacggcacgctgcagggagcgctggag
ctgctgggcattccgtacaccggcagcgggccgctggcctccagcctgtcgatggacaag
atcatgaccaagcgggtgtggctgcagcatggcctgcccacgccggccttcgaggtgctg
ggcggcagcaccgaactgcgcctggtgcccgaccgcctgggcctgccgttgatactcaag
ccgccgcacgagggctcgaccgtcggcatcaccaaggtggcgggctattcggacatgaag
gcggcgtacgagctggccgcgcgcttcgacgccgaggtgctggccgaacagttcatcacg
ggccgcgaactgaccgtcgccgtgctgggttcgggcgccgcggcgcgcgccttgccggtg
atcgagatcgtcgcacccggcggcaattacgactacgaacacaagtacttctcggacgac
acccagtacttctgcccggccgacctgcccgcggacgtggccgcggacgtggccgccgtc
gccgagcgcgcctacgccgcgctgggctgcgagggttggggccgggtcgacttcatcctg
gaccgggagaaccggccctggctgctggaaatgaatacttcgcccggcatgaccggccat
tcactggtgccgatggcggcgcgcgcggtgggcatgagctatgccgacctgtgcgtggcc
atcctggccgaggccgcgtgcaaagtgcgcagcccggcgcgacaagattga

DBGET integrated database retrieval system