KEGG   Bordetella bronchiseptica MO149: BN115_4071Help
Entry
BN115_4071        CDS       T02295                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
bbm  Bordetella bronchiseptica MO149
Brite
KEGG Orthology (KO) [BR:bbm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bbm03016]
    BN115_4071
Enzymes [BR:bbm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     BN115_4071
Transfer RNA biogenesis [BR:bbm03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    BN115_4071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB UPF0158
Motif
Other DBs
NCBI-ProteinID: CCJ60827
LinkDB All DBs
Position
4456103..4457986
Genome map
AA seq 627 aa AA seqDB search
MYVFYDDDGGFKAGNILSETDASLQVESETGKRSKIKRASTLFTFAAPEPAALMAQAATL
AEDIDLQFLWECAPQEEFDAPALAAEYFGHAPGPVEQAALLMRLHGAPAYFHRRGKGRYR
PAPPDILAAALAALEKKRLQAEQQQQWIDEMAQGRLPEAIAQAAESLLVRPDKNSMQWKA
FDAACTQLQKTPERLLLDLGAWPHPLALHKRRFLAVNFPRGVGFPAMDVPSIERELPLAE
GEIYSVDDITTTEIDDALSVSALPDGKIRVGIHVAAPGLAITRGSEHDKLARTRLSTVYM
PGEKIPMQPDNVIQAFSLDAGRPVPAVSLYVTADPRTGAIEASETRLERIVVRENLRHND
LDAQISEAALADPDAPLAYGHWLRPLWQLAQALGAQREAVRGKPENNTRVEYSFYLDGSP
DDPDTPVRLVPRQRNAPLDRMVAEYMILANNIWGGLLHQHGVPGIYRSQQAGRVRMSTQA
LPHEAIGVPQYAWSTSPLRRYVDLVNQWQLIAAVEHGVSARLVAPFKPRDADLYAIIGAF
DAQYAAWADFQNAMERYWCMRWLKQQGISRTTAHVLREDLVRLANAPLVTRVGGLPELER
GAAVQIDIMNMDELALELDCRYLGPAD
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtgttttacgacgacgacggcggcttcaaggccggcaatatcctgtccgagacc
gacgccagcctgcaggttgagtcggaaacgggcaagcgcagcaagatcaagcgcgccagc
accctgttcaccttcgcggcgccggagccggccgcgctgatggcccaggcggccacgctg
gccgaggacatcgacctgcagttcctctgggagtgcgcgccgcaggaggaattcgacgcg
cccgcgctggcggccgagtacttcggccacgcccccggcccggtcgagcaggccgccctg
ctgatgcgcctgcacggcgcgccggcctatttccatcgccgcggcaagggccgctaccgt
ccggccccgcccgacatcctggccgccgccctggccgcgctggagaaaaagcgcctgcag
gccgaacagcagcagcaatggatcgacgaaatggcccagggccgcctgcccgaggccatc
gcccaggcggccgaatcgctgctggtccgcccggacaagaattcgatgcagtggaaggcg
ttcgacgccgcctgcacccagctgcagaagacgcctgagcgcctgctgctggacctgggc
gcctggccgcatccgctggcgctgcacaagcggcgcttcctggccgtgaacttccccagg
ggcgtgggatttccggccatggacgtgccgtcgatcgaacgcgagctgccgctggccgag
ggcgagatctactcggtcgacgacatcaccaccaccgagatcgacgacgcgctgtcggtc
agcgccctgcccgacggcaagatccgcgtcggcatccacgtcgccgcgcccggcctggcc
attacgcgcggcagcgaacacgacaagctggcgcgcacccgcctgtccacggtctacatg
ccgggcgagaagattccgatgcagcccgacaatgtgatccaggcgttttcgctggacgcg
ggccggccggtgccggccgtgtcgctgtatgtcacggccgacccgcgcaccggcgcgatc
gaagcctcggaaacccgcctggaacgcatcgtggtgcgcgagaacctgcgccacaacgac
ctggacgcgcagatttccgaagccgcgctggccgatccggacgcccccctggcttatggc
cactggctgcggccgctgtggcagctggcgcaggcgctgggcgcgcagcgcgaagccgtg
cgcggcaagcccgaaaacaatacgcgggtcgaatacagcttctacctggacggcagcccg
gacgacccggataccccggtgcggctggtgccgcgccagcgcaacgcgccgctggaccgc
atggtggccgagtacatgatcctggccaacaacatctggggcggcctgctgcaccagcac
ggcgtgccgggcatctaccgctcgcagcaggccggccgggtgcgcatgagcacgcaggcg
ctgccgcacgaagcgatcggcgtgccgcaatatgcctggagcacctcgccgctgcgccgc
tatgtcgacctggtcaaccagtggcaattgatcgcggccgtcgagcacggcgtgtcggcg
cgcctggtggcgcccttcaagccgcgcgacgccgacctctatgccatcatcggcgcgttc
gacgcgcagtatgcggcctgggcggatttccagaacgccatggagcgctattggtgcatg
cgctggctcaagcagcagggaatcagccgcacgaccgcccacgtgctgcgcgaggatctg
gtgcgcctggccaacgcgccgctggtcacgcgcgtgggcggcctgcccgagctggaacgc
ggcgcggcggtgcagatcgacatcatgaatatggacgaactggcgctggagctggactgc
cgctacctggggccggcggactga

DBGET integrated database retrieval system