KEGG   Bordetella bronchiseptica MO149: BN115_4530Help
Entry
BN115_4530        CDS       T02295                                 

Gene name
hisE
Definition
(GenBank) phosphoribosyl-ATP pyrophosphohydrolase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm00340  Histidine metabolism
bbm01100  Metabolic pathways
bbm01110  Biosynthesis of secondary metabolites
bbm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BN115_4530 (hisE)
Enzymes [BR:bbm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BN115_4530 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: CCJ61286
LinkDB All DBs
Position
4940008..4940355
Genome map
AA seq 115 aa AA seqDB search
MTTPTAGDDILSRIADTLATRRPEAGGDPQSSYVAKLLSKAPDAFLKKIGEEATELVMAA
KDGQPDRIISETADLWFHCLVALTHYNLRPEDVLAELARREGLSGLEEKARRPRD
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccgaccgccggcgacgacatcctgtcgcgcatcgccgataccctggccacg
cgccgccccgaggccggcggcgatccgcagtcgtcctacgtcgcgaagctgctgtccaag
gcgcccgacgccttcctgaagaagatcggcgaagaagccaccgagctggtcatggcggcc
aaggacggccagcccgaccgcatcattagtgaaaccgctgatctctggttccactgtctg
gtagccttgacccattacaatctgcgacccgaggacgtactggccgagctggcgcgccgc
gagggattgtccggcctcgaggaaaaggcccggcggccgcgagactga

DBGET integrated database retrieval system