KEGG   Borreliella burgdorferi N40: BbuN40_0243Help
Entry
BbuN40_0243       CDS       T02075                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase, anaerobic
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bbn  Borreliella burgdorferi N40
Pathway
bbn00564  Glycerophospholipid metabolism
bbn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BbuN40_0243
Enzymes [BR:bbn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BbuN40_0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADQ29436
LinkDB All DBs
Position
247340..248923
Genome map
AA seq 527 aa AA seqDB search
MEEYLNFMNNNKETKLKDLENQEFDLIIIGGGATGLGIAVDAITRGYKAILIEKFDYAKG
TSSRSSKLIHGGVRYLAQWNISLVKEALREKAILEKNAPHLINECALITPIYNVLEIPYY
YFGLSYYHNLMGKEKTTKYKTKLLSKKSTIEKAPNIKTEGLKCSVLYYDDSFDDARMAIT
LLRTFTEKGGIALNYTELKKFNKENGKLSGVLIQNKLSKEQISLKSKCIINATGIFSDEI
RRLDDEKALNIIKPSQGSHLVVKKDKFPKNHAILIPKTSDNRILFAIPWYDSVVCGSTDI
PIKEIEEEPKRFEEEIDFIINNLNNYLNIKIEKSDVKSVYTGIRPLIMDPKAQGNTSKIS
RNEKIFISDSNLITIAGGKYTTYRKMAEKTLLKAIEQNLIPNRAPTTEDLKLHGYLKKEE
AMKIPEPFRAYGSDFEILKNMEGFDKKIHENLDLNEAQIDFSIKFEQAKTIEDVLARRTR
SLPLNPQATIEAAPRVAEIMMEKLNKSEEWKNEQIKNFLEISKKYLI
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatatttaaatttcatgaataataacaaagaaacaaaattaaaagatcttgaa
aatcaagaatttgatcttataataattggagggggcgcaacaggtcttggcattgcggta
gacgcaattacaagggggtataaagcaatacttatagaaaaatttgattatgcaaaagga
acttcctctagatcaagcaaattaattcacggtggagtaagatatttagcccaatggaat
atttctttggttaaagaagctttgcgcgaaaaagccattcttgagaaaaatgcaccccat
ttaattaacgaatgtgcacttatcacgcctatttataatgttttagaaataccttattat
tattttggattaagttactaccacaatcttatgggtaaagaaaaaactactaaatacaaa
actaaattactatccaaaaaatctaccattgaaaaagctcccaatattaaaacagagggc
cttaaatgctccgttctatattacgatgattcattcgatgatgctagaatggcaataaca
ttgttaagaacctttaccgaaaaaggaggtattgcccttaactatacagaacttaaaaaa
ttcaacaaagaaaacggaaagctttcgggagttctcatacaaaataaattgtcaaaagaa
caaatttcattaaaaagcaaatgcataataaacgcaacaggaatattttcagatgaaata
agaaggttggatgatgaaaaagccttaaacatcattaaaccttcccaaggtagccattta
gtagtcaaaaaagacaaatttcccaaaaatcatgcaatattaatacctaaaactagtgat
aataggattttattcgctattccttggtatgatagtgttgtttgtggaagcactgacatt
ccaataaaagagatagaagaagaacccaaaagatttgaagaagagattgactttataata
aataatttaaataactatttaaatattaaaatagaaaaatcagatgtaaaaagtgtatat
accggaataaggccattaataatggatccaaaagctcaaggaaacacttcaaaaatctca
agaaacgaaaaaatatttatatcagattcaaatcttattacaatagcgggggggaaatat
accacatatagaaaaatggcagaaaaaaccttgcttaaggccatagaacaaaatttaata
ccaaatcgtgcaccaactacagaagatttaaagttgcacggctaccttaaaaaagaagaa
gcaatgaaaattcctgaaccttttagagcttatggcagcgactttgaaattctaaaaaat
atggagggttttgacaaaaaaatacacgaaaacttggatttaaatgaagctcaaatagat
ttttcaattaaatttgaacaagccaaaactattgaggatgttttagcaagaagaacaaga
tcactacctttaaatcctcaagctacaattgaggctgctccaagagttgctgaaataatg
atggaaaaattaaataaatctgaagagtggaaaaatgaacaaataaaaaactttttagaa
ataagtaaaaaatatttaatttaa

DBGET integrated database retrieval system