KEGG   Babesia bovis: BBOV_I002740Help
Entry
BBOV_I002740      CDS       T01085                                 

Gene name
19.m02242
Definition
(RefSeq) 200 kDa antigen p200
Organism
bbo  Babesia bovis
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_1
Motif
Other DBs
NCBI-GeneID: 5477140
NCBI-ProteinID: XP_001608924
UniProt: A7AWC8
LinkDB All DBs
Position
1
AA seq 1023 aa AA seqDB search
MARERRHISLTKMLNLLSVALGCYFAGKHVYAFRTESSVARQHAADNNVELGSIQASLRP
DSSLESTHTSADIAPRGNGGRRSGVDTTPQQDVQTLISYYNGLGGKGFTKDNAQQCLEWE
PLANCTKKQFLRCINPPDSTLTMKCFNDKCGDWSPWTICNNGIQYRYRPECDGEYIQYKN
CSEKNWVEFKAEQEALEAERKRQEALEAERKRQEAEAERKRQEALEAERKRQEALEAERK
RQEAEAERKRQEALEAERKRQEALEAERKRQEAEAERKRQEALEAERKRQEALEAERKRQ
EAEAERKRQEALEAERKRQEALEAERKRQEAEAERKRQEALEAERKRQEALEAERKRQEA
EAERKRQEALEAERKRQEALEAERKRQEAEAERKRQEALEAERKRQEALEAERKRQEAEA
ERKRQEALEAERKRQEAEAERKRQEALEAERKRQEALEAERKRQEAEAERKRQEALEAER
KRQEALEAERKRQEAEAERKRQEALEAERKRQEALEAERKRQEAEAERKRQEALEAERKR
QEALEAERKRQEAEAERKRQEALEAERKRQEALEAERKRQEAEAERKRQEAEAERKRQEA
EAERKRQEEAEAERKRQEEAEAERKRQEEAEAERKRQEEAEAERKRQEEAEAERKRQEEA
EAERKRQEEAEAERKRQEEAEAERKRQEEAEAERKRQEEAEAERKRQEEAEAERKRQEEE
EQARIAAERKQQEEEEARQAAERKRQEEERQKEERLAKEALQKRLAEEAAQKRLEQMRRQ
AEEKLRKEKEAEMKRQEEEEQARIAAERKQQEEEEARQAAEKKQQEEEAARQEAERKRQQ
EEEEARQAAEKKQQEEEAARQEAERKRQQEEEEARQAAEKKQQEEEAARKEAEEQLANEK
SRVYDVIESSEVPSSVLPTDQESTDRVMDGEPDEEEQEENARKSSRKSLVKQASVGLAAV
MSVVVGSYIYCKSPVSAGSAMAPGVSEQGFDDQSYLNHRSDDVETKVDFDENFWSNAADQ
NNE
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgaaagacgtcatatcagtttaacaaaaatgttgaacttattatcagtagca
ttaggttgctattttgcagggaagcatgtttatgcttttcgcactgaatcatccgtggct
cgtcaacacgctgctgacaacaatgtagaattgggttctatacaggcatctcttagacct
gactctagtttagagtctactcacacgtcagccgatatcgctcctcgtggcaatggtggc
cgtagaagcggcgtcgacactacacctcagcaggacgttcagactcttatatcatactac
aatggtttgggcggcaagggattcaccaaggacaatgcccagcaatgtttagaatgggaa
ccattggctaactgtacgaaaaaacagttcctcaggtgtattaaccctcctgactcaaca
ctcactatgaagtgctttaacgataagtgtggtgactggtcaccatggactatctgtaac
aatggtattcaatacagataccgcccagaatgtgacggagagtacattcaatacaagaac
tgctcagagaagaactgggttgaatttaaggcagagcaagaagccctagaagctgagagg
aagaggcaagaagccctagaagctgagaggaagaggcaggaagccgaggctgagaggaag
agacaggaagccctagaagctgagaggaagaggcaagaagccctagaagctgagaggaag
aggcaggaagctgaggctgagaggaagaggcaggaagccctagaagctgagaggaagagg
caagaagccctagaagctgagaggaagaggcaggaagccgaggctgagaggaagagacag
gaagccctagaagctgagaggaagaggcaagaagccctagaagctgagaggaagaggcag
gaagctgaggctgagaggaagagacaggaagccctagaagctgagaggaagaggcaggaa
gccctagaagctgagaggaagaggcaggaagctgaggctgagaggaagagacaggaagcc
ctagaagctgagaggaagagacaggaagccctagaagctgagaggaagaggcaggaagcc
gaggctgagaggaagagacaggaagccctagaagctgagaggaagaggcaagaagcccta
gaagctgagaggaagaggcaggaagctgaggctgagaggaagaggcaggaagccctagaa
gctgagaggaagaggcaagaagccctagaagctgagaggaagaggcaggaagccgaggct
gagaggaagagacaggaagccctagaagctgagaggaagaggcaggaagctgaggctgag
aggaagagacaggaagccctagaagctgagaggaagaggcaggaagccctagaagctgag
aggaagaggcaggaagctgaggctgagaggaagagacaggaagccctagaagctgagagg
aagagacaggaagccctagaagctgagaggaagaggcaggaagctgaggctgagaggaag
agacaggaagccctagaagctgagaggaagaggcaggaagccctagaagctgagaggaag
aggcaggaagctgaggctgagaggaagagacaggaagccctagaagctgagaggaagaga
caggaagccctagaagctgagaggaagaggcaggaagctgaggctgagaggaagagacag
gaagccctagaagctgagaggaagagacaggaagccctagaagctgagaggaagaggcag
gaagctgaggctgagaggaagaggcaggaagctgaggctgagaggaagagacaggaagct
gaggctgagagaaagaggcaagaggaagccgaggctgagagaaagaggcaagaggaagcc
gaggctgagagaaagagacaagaggaagccgaggctgagagaaagagacaagaggaagct
gaggctgagagaaagagacaagaggaagctgaggctgagagaaagagacaagaggaagct
gaggctgagagaaagagacaagaggaagctgaggctgagagaaagaggcaagaggaagct
gaggctgagagaaagaggcaagaggaagctgaggctgagagaaagagacaagaggaagct
gaggctgagagaaagaggcaagaggaagctgaggctgagagaaagaggcaagaagaagag
gagcaggctcgcattgctgctgaaaggaagcagcaagaggaagaagaagcccgtcaagcc
gctgaaaggaagaggcaagaagaggaaaggcaaaaggaagaacgtttggctaaggaagcg
cttcagaaacgccttgctgaagaggctgcacagaaacgtttggaacaaatgagacgccaa
gcagaggagaaattacgcaaagaaaaagaagctgaaatgaagagacaagaggaagaggag
caggctcgcattgctgctgaaaggaagcagcaagaggaagaggaagcccgtcaagccgct
gagaagaagcagcaagaggaagaggccgcccgccaagaagccgagaggaagaggcagcaa
gaagaagaggaagcccgtcaagccgctgagaagaagcagcaagaagaagaggccgcccgc
caagaagccgagaggaagaggcagcaagaagaagaggaagcccgtcaagccgctgagaag
aagcagcaagaggaagaggcagcccgtaaagaagcagaggaacagctggcaaatgaaaag
agcagagtctatgacgtaattgagtcctctgaagttcctagctctgttttacccaccgat
caagaatccactgatcgtgtaatggacggcgaaccagatgaagaagaacaggaagagaat
gcaagaaagtcgtcgcgtaaatcgttggttaagcaagcatctgttggtctcgctgctgtt
atgtccgtggttgttggttcatacatttattgcaagtcccctgtgagcgctggttccgct
atggccccgggtgtttctgaacaaggtttcgatgatcaatcatatttgaaccacagaagt
gacgacgtagaaaccaaggtcgactttgatgaaaacttctggtcgaacgctgccgatcaa
aacaatgagtag

DBGET integrated database retrieval system