KEGG   Babesia bovis: BBOV_IV007210Help
Entry
BBOV_IV007210     CDS       T01085                                 

Gene name
23.m06369
Definition
(RefSeq) succinate dehydrogenase alpha subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bbo  Babesia bovis
Pathway
bbo00020  Citrate cycle (TCA cycle)
bbo00190  Oxidative phosphorylation
bbo01100  Metabolic pathways
bbo01110  Biosynthesis of secondary metabolites
bbo01130  Biosynthesis of antibiotics
bbo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBOV_IV007210 (23.m06369)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BBOV_IV007210 (23.m06369)
Enzymes [BR:bbo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BBOV_IV007210 (23.m06369)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_binding_3 Thi4 DAO Pyr_redox_3 HI0933_like Lycopene_cycl Lin0512_fam
Motif
Other DBs
NCBI-GeneID: 5478879
NCBI-ProteinID: XP_001610645
UniProt: A7ARA8
LinkDB All DBs
Position
4
AA seq 624 aa AA seqDB search
MFSNLGIINKLSKFGRKFSSEAVSRNISGHTVVEHTYDAVIVGAGGAGLRAALELSSTGY
KTACVSKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGSDWLGDQDAIHYMCKE
APQAVIELENYGLPFSRTEEGKIYQRAFGGQSLKFGKGGQAYRCAAAADRTGHAMLHTLY
GQSLAKKCQFFIEYFLLDLLHDNGQVVGCICMRMSNGEIHVFKTNHVILATGGYGRCYFS
CTSAHMCTGDGNAAVSRAGFPLQDMEFVQFHPTGIYPAGCLITEGCRGEGGILRNVEGEP
FMSRYAPVAKDLASRDVVSRAMTCEILEGRGCGPNKDHIYLDLTHLSDEVFREKLPGITE
TAKIFAGVDARKQYIPVLPTVHYNMGGIPTNWRAEAINRDNSKIPGLYAAGETACASVHG
ANRLGANSLLDIVVFGKRAALSVMESSKPGDATKASEKAIQNAVDATIDKITKILATASK
DGIPTSEIRLEMQKAMQDNVAVFRDGERLQKGVKMIRDCVDKFKDVKINDTSPAFNTDLY
ETLELENLLIQAMQTVASAEARKESRGAHSREDYPKRDDENWRKHTLSYFDSNDLKDVKL
AYRAVIDATLGDDMETIPPFERTY
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcaacttgggaattataaataaactcagcaaatttggacgcaagttttcttcc
gaagctgtaagtcgcaacatctcaggtcacacggttgttgagcatacttacgatgcggtt
atagtcggagcgggtggagctgggctgcgggctgcgcttgagctcagttctactgggtac
aagacagcatgtgtatcgaagctatttccaaccaggagtcatacagtggccgctcagggc
ggtattaacgcagcccttggtaacatgaccgaagatgactggaggtggcatgcttacgat
acagtcaagggatctgattggctaggagaccaagacgcaatacactatatgtgcaaagaa
gctccacaggcagtcatcgaacttgaaaactatggtctaccgttcagccgaacagaggaa
ggtaaaatatatcaacgtgcattcggagggcaatcgctgaagtttggtaagggaggtcaa
gcttatcgttgcgccgccgctgctgacaggactggacatgctatgttgcatacattatat
ggccagtcacttgccaaaaaatgccagttctttattgaatactttttgctagatttgctg
cacgataacggacaggtagtaggatgcatttgtatgcgcatgtccaacggagaaatacat
gtgtttaaaactaaccacgttattctggcaacaggtggttatggaaggtgctattttagt
tgtacctcagcacatatgtgtaccggagatggtaatgccgctgtgtcacgtgctggcttc
ccactacaggacatggagttcgttcagtttcacccaacgggtatatatcccgctgggtgc
ttgattactgagggttgtcgcggtgaaggtggtattctacgtaatgttgagggtgagcct
tttatgagtcgatatgcccctgtggccaaggaccttgcctctcgtgatgttgtatccagg
gctatgacatgcgaaattcttgaaggaagaggctgtggaccaaacaaagaccacatttac
ttagatctgacacacctgagtgatgaggtattccgtgagaagctgcctggaatcactgaa
acagcgaaaatctttgcaggtgttgatgcaaggaaacaatatatcccagtgctaccaact
gtacattacaacatgggtggcattcctaccaactggagagctgaagctataaatagggat
aactcaaagatccctgggttgtacgcagccggggaaacggcatgtgcttctgtacacgga
gctaatagactaggtgctaacagcctcttggatattgtagtctttggtaaaagggctgct
ttatcggtaatggagagttccaagcctggagatgctacaaaagcaagtgagaaagctatc
caaaacgcagtcgacgcaactattgacaagataaccaagatattggcaactgcatccaag
gacggcattcccacttctgaaatccgtttggaaatgcaaaaggcaatgcaagataatgtc
gccgtattcagagatggagaacgactgcaaaagggtgtcaagatgatacgtgattgtgtc
gacaaattcaaggatgttaagattaatgacacttcacctgcgttcaacacagacttgtat
gaaaccctggaactggaaaatctactaatccaggctatgcaaactgtagcatctgctgaa
gcacgcaaagaatctagaggagctcactcacgagaagattacccgaagagggacgatgag
aattggaggaagcacacgttgtcatattttgattcaaacgatctcaaggacgttaaactt
gcatatcgtgcagtaatcgacgctacactcggtgacgacatggaaactataccaccattc
gaaaggacgtactga

DBGET integrated database retrieval system