KEGG   Bifidobacterium bifidum PRL2010: BBPR_0262Help
Entry
BBPR_0262         CDS       T01340                                 

Gene name
ddlA
Definition
(RefSeq) d-alanine--d-alanine ligase DdlA
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bbp  Bifidobacterium bifidum PRL2010
Pathway
bbp00473  D-Alanine metabolism
bbp00550  Peptidoglycan biosynthesis
bbp01100  Metabolic pathways
bbp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bbp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BBPR_0262 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BBPR_0262 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BBPR_0262 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bbp01011]
    BBPR_0262 (ddlA)
Enzymes [BR:bbp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BBPR_0262 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:bbp01011]
 Precursor biosynthesis
  Amino acid ligase
   BBPR_0262 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-GeneID: 9888430
NCBI-ProteinID: YP_003970425
UniProt: A0A0H3EAP3
LinkDB All DBs
Position
318676..319821
Genome map
AA seq 381 aa AA seqDB search
MAETAKIRVVVMYGGKADEHSISCISTAGVLRALDTDRFEPVPVGITKQGQWIVDGEDPR
GWDMADGLPVVEKTPGSRDVVLDVALGQDGFFARNDDGTLSSLGHVDAVLPVLHGPYGED
GTIQGLLEMMDVPYVGCGVLASAACMDKHYTKVLLAAAGIPVAPGITVDARGFDAASRFA
ADADGLLAQVEEAGLAYPLFVKPSRAGSSFGVTKVEHAGDAAELAAAVFEASHHDWRILI
EQGIDAREIECAVLCPKAGSEPQASWPGEIVLDKRNSGGDQFYDFDSKYMDSSASHVEVP
ANLPQETLQQVRETAIKAFKAVDGAGLSRVDTFVTPDGEVMVNEINTMPGFTPISMYPKA
WEATGIGYTELITKLIDGVLR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaacggccaagattcgcgttgtggtgatgtatggcggcaaggccgacgagcat
tcgatttcctgcatttcgactgccggcgtgctgcgcgcgcttgacaccgaccggttcgag
ccggtgccggtgggcatcaccaagcagggccagtggatcgtggacggcgaggacccgcgc
ggatgggatatggccgacggtctgccggtcgtcgagaagactcccggctcgcgcgacgtc
gtgctggacgtggcgctcgggcaggatggcttcttcgcccgcaatgacgacggcacgctg
agctcgctggggcacgtggacgcggtgctgccggttctgcacggcccgtatggcgaggac
ggcacgattcagggtctgctggagatgatggatgtgccgtacgtcggttgcggcgtgctc
gcgtccgccgcgtgcatggacaagcattacacgaaggtgctgctggccgccgccggcatt
ccggtcgctcccggcatcaccgtggacgcgcgcggcttcgacgcggcgtcacggttcgcc
gctgatgccgatggtctgctcgctcaggtcgaggaggccggactggcgtacccgctgttc
gtcaagccgtcccgcgccggatcgagcttcggcgtgaccaaggtggagcatgccggtgac
gccgccgagctggccgccgccgtgttcgaggcgagccatcatgattggcgaatcctgatc
gaacagggcatcgacgcgcgtgagatcgagtgcgcggtgctgtgcccgaaggccggcagt
gagccgcaggccagctggccgggcgagatcgtgctcgacaagcgcaacagcggcggcgac
cagttctacgacttcgacagcaagtacatggattcgtcggcgagccatgtggaggtgccg
gcgaatctgcctcaggagactctgcagcaggtgcgcgagaccgcgatcaaggcgttcaag
gcggtggatggcgccggcctgagccgcgtggacacgttcgtgacaccggacggcgaggtg
atggtcaatgagatcaacacgatgcccggtttcacgccgatctccatgtatccgaaggca
tgggaggcgaccggcatcggctataccgagctgatcaccaagctgatcgacggcgtgctg
cgctag

DBGET integrated database retrieval system