KEGG   Blattabacterium sp. (Blatta orientalis): BLBBOR_097Help
Entry
BLBBOR_097        CDS       T02446                                 

Definition
(GenBank) SecD/SecF fusion protein
  KO
K12257  SecD/SecF fusion protein
Organism
bbq  Blattabacterium sp. (Blatta orientalis)
Pathway
bbq02024  Quorum sensing
bbq03060  Protein export
bbq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bbq00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BLBBOR_097
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BLBBOR_097
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BLBBOR_097
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbq02044]
    BLBBOR_097
Secretion system [BR:bbq02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   BLBBOR_097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD_SecF Sec_GG
Motif
Other DBs
NCBI-ProteinID: AGD98007
UniProt: L7YCE9
LinkDB All DBs
Position
complement(97940..100801)
Genome map
AA seq 953 aa AA seqDB search
MRIRNFFTIFIVSLLTVICLYYILFSLYVYKLERDAYLYSKGNLEIEKKYLESKKRIGLL
KYNHFSARNKVLNLGLDLRGGISFILEISEKDLLKKFSNNSKNPVFLKALNHADKEKEKN
PNVDYFSSFLNFFYRNKKKIQTDFSISDFFVNRSYVDEINYTDRDLEKVIRKKIELSISD
THNILISRMDKFGVVQPNVQRIKKSNRILIELPGIENIDRVKNILQKRAELHFFEIYNFR
EIFPYFEKINKIYSENEKLERFEPNNFSSARKTRSFIEMLNISKINKMDNNLVVGLVHKK
EMNKITYFLNSMDVVEYLPYTLRNIKFLWGSKTYQYNQEKYVPLFAVKEENNSLNGDIIT
SVYKSFGPFNEIFINIKMNQEGAKNWKIFTEKNIGRNIAIVLDDLVYTAPFVKSVIPNGI
SQISGNLSLQESEDLVNVLSTGRLPTSVKIIQSEVVGPSLGKETIRKGIFSFFIAIIFVF
IWMFYYYIIPGLYANIALIFNFVFILGFLISINSVLTFPGIAGIILTLAMSMDSYVLIYE
KIKEDMRNGTSIRSAIHNSYTFQGALSSIIDGQVTTLLCGIILFFFGIGPIKGFSTTLII
GIFTSFFSSICLGKLFLEWHLNKYKKIFFRIWNSNKVSWDFLSKRKFSYAISFICILGSL
ISFYYKGLNLGIDFVGGRTYIIRFDRKVLPDHISFLLSKYFIENGKPSSPKVLPFGEENK
MKIVTKYKIWNENNQIDQEILKNVLALKPYFHTIDFQDFKTIDKDKSLGILSSEKVEPVI
AKYITKNAFISILLSLFGIFFYIFIRFKKWKFGLGALVSLLHDTIIVLGLFSIFHERFSV
LEINQSFIAALLTIIGYSINDTVIVYDKIRKFSGTESFSIKEIINKGINSSLTRTMNTSF
ITIWAICIILFFGGTTIRSFMLALLFGVSIGTYSSIFIASSIVYDLSKKKEKK
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgcggataagaaatttttttacgatttttatcgtctctttacttactgttatttgttta
tactacattctttttagcctttatgtttataaattagaaagggatgcttatttgtattct
aaaggaaacttagaaatagaaaaaaaatatcttgaatctaaaaaaagaataggattatta
aaatataatcattttagtgcaagaaataaagttttaaatttaggtttagatttaagagga
ggaatcagctttattttagaaatatctgaaaaagatttattaaaaaaattttctaataat
tccaaaaatcctgtttttttaaaagcattaaatcatgcagataaagaaaaagaaaaaaat
cctaatgtagattatttttcttcttttctaaactttttttataggaataaaaagaaaatc
caaacagatttttctatttcagatttttttgtaaatagatcttatgtagatgaaataaac
tatacagatagagaccttgaaaaggttattagaaaaaaaatagaattatctatttctgat
actcataacattcttatatctagaatggataaatttggagtagtccaaccgaatgtacaa
agaatcaagaaatccaatcggattttaatagaattacctggaatagaaaatatagataga
gtaaaaaatattttacaaaaaagagcagaattacacttctttgaaatatacaattttcga
gaaatttttccttattttgaaaaaataaataaaatttattcagaaaatgaaaaattagaa
cgatttgaaccgaataatttttcctctgcaagaaaaactaggtctttcatagaaatgtta
aacatttccaaaataaacaagatggataataatcttgttgtaggattagtccataagaag
gagatgaacaagattacctattttttaaactctatggacgtagtagaatatttaccatat
actttacgaaatataaaatttttatggggatctaaaacctatcaatataatcaggaaaaa
tatgttccgttatttgctgtaaaagaagaaaataattccttgaatggggatattattact
agtgtatataaatcttttggacctttcaacgaaatattcatcaatataaaaatgaatcag
gaaggagctaaaaattggaaaatatttactgaaaaaaatattggaagaaacatagctata
gttcttgatgatttagtttacacagcaccttttgtaaaatcagtcattcctaatggaata
tctcaaatatctggaaatttatctttacaagaatctgaagatttagtaaatgtactaagt
acaggtagattgcctacttcagtcaaaataattcaatcagaagtagtgggtccttctttg
ggaaaggaaactatacggaaaggaatattttctttttttatagccattatttttgtattt
atttggatgttttattattatataattccaggattatatgctaacatagcattaattttt
aattttgtatttatacttggttttcttatttccattaattctgtattaacctttcctgga
attgcaggtattatattaacattagccatgtccatggattcgtatgttctaatttatgaa
aaaattaaagaagatatgagaaatggaacatctattcgttcagctatacataatagttac
acttttcaaggagctttatcatctattattgatggacaagttactactttattatgcgga
attatcttatttttctttggaataggacctattaaaggtttttctactaccttaattatt
ggaatttttacctcttttttttcttctatatgtttgggaaaattatttttagagtggcac
ttaaataagtataaaaaaatattctttagaatatggaattctaataaagtttcatgggat
tttttatctaaaagaaaattttcttatgctatttcctttatatgcattttaggaagtctt
atctccttttattataaaggattaaatcttggaatagactttgtaggaggtcgtacttat
attattcgttttgatcgtaaggtcttaccagatcacatttcttttcttttatccaaatat
tttatagaaaacgggaagccttcttctccaaaagttcttccttttggagaagaaaataaa
atgaaaatagtaactaaatacaaaatatggaatgaaaacaaccaaatagatcaagaaatt
ttgaaaaatgttttggcattaaaaccgtattttcatacgatagatttccaggattttaaa
actatagataaagataaatctttaggaatattgtcatcagaaaaagtagaacctgttata
gcaaaatatataactaagaatgcttttatttcaatacttttgtccttatttggaatattt
ttttatatttttatcagatttaaaaaatggaaatttggtttaggagctttggtttctttg
ttacatgatacaataattgtacttgggttattttccatatttcatgaacgtttttctgtt
ttagaaataaatcaatctttcatcgccgcattgttaacaataataggttattctatcaat
gatacagtaattgtgtatgataagattcgaaaattttcagggactgaatcgttttccata
aaagaaattataaacaaggggattaatagttctttaacaagaaccatgaatacctcattt
attaccatatgggctatatgtattattttattctttggaggaactactattcgtagtttt
atgttagctttgttgtttggagtaagtattggaacttattcttctatatttatcgcatcc
tccatagtatatgatctttctaaaaaaaaagaaaaaaaatga

DBGET integrated database retrieval system