KEGG   Bordetella bronchiseptica RB50: BB1035Help
Entry
BB1035            CDS       T00141                                 

Definition
(GenBank) putative ribulose bisphosphate carboxylaseoxygenase,large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00630  Glyoxylate and dicarboxylate metabolism
bbr01100  Metabolic pathways
bbr01120  Microbial metabolism in diverse environments
bbr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BB1035
Enzymes [BR:bbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BB1035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CAE31534
GeneDB: BB1035
UniProt: Q7WNK2
LinkDB All DBs
Position
complement(1116443..1117714)
Genome map
AA seq 423 aa AA seqDB search
MSDRFEATYLIETPHDVASVAQELAGEQSTATSSRMPGETDALIRDFGARVEHIEALPPA
EAPSLPVAHTLGQRVHRARLTLSWPLHNIGDSLPMLLTTLLGNQTGMRRLSGIRLERVAM
PQSFIAAQPRPAFGIAGTRRLTGVQGRPLIGSIVKPNIGLAPEQTAAMARQLAEGGVDFI
KDDELLANPPYSPVARRAALVLRALDEAAQRTGRRTMYAVNITDGLDEMRRHHDAVVQAG
GTCIMVNLNSVGLSALLALRRHSQLPIHGHRAGWAMMTRCPALGMEFQPYQMLHRLAGVD
HLHVSGLGGKFWEHADSVLQAAHECLTPLDTQAGAADDRALPVFSGGSTIFDVAPTYQGI
GTADLIFASGGGIFGHPDGLAAGCASLRQAWEAAIAGQELRAYAQSRPELAAALARGKPV
RKA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcgcttcgaggcgacctacctgatcgagacgccgcatgacgtcgcaagcgtc
gcccaggaactggccggcgaacaatccaccgccacgtccagccgcatgccgggcgaaacc
gacgccttgatccgcgacttcggcgcccgcgtcgaacacatcgaggcgctgccgccggcc
gaggcgcccagcctgccggttgcccatacgctgggccagcgcgtgcaccgcgcgcgcctg
acgctgtcgtggccgctgcacaatatcggcgactcgctgcccatgctgctcaccacgctg
ctgggcaaccagaccggcatgcggcgcctgagcggcatccgcctcgaacgcgtcgccatg
ccgcagtccttcatcgcggcgcagccgcggccggccttcggcatcgccggcacgcgccgc
ctgaccggcgtgcaaggccgtccgctgatcggcagcatcgtcaagcccaacatcggcctg
gcgccggaacagaccgcggccatggcgcgccagctcgccgaaggcggcgtcgatttcatc
aaggacgacgaactgctggccaacccgccctattcgcccgtggcccggcgcgccgccctg
gtgctgcgcgcgctggacgaggcggcccagcgcaccggccggcggaccatgtacgccgtc
aacatcaccgacggcctggacgaaatgcggcgccatcatgacgccgtcgtgcaggccggc
ggcacctgcatcatggtgaacctcaacagcgtcggcctgtcggccctgctggcgctgcgc
cgccacagccagctgcctatccacggccatcgcgccggctgggccatgatgacgcgctgc
ccggcgctgggcatggaattccagccctaccagatgctgcaccggctggccggcgtcgac
cacctgcatgtcagcggcctgggcggcaagttctgggagcacgccgacagcgtgctgcaa
gcggcccacgagtgcctgacgccgctggatacgcaggccggcgccgcggacgaccgcgcc
ctgcccgtgttctcgggcggctccaccatcttcgacgtggcgcccacctaccagggcata
ggcacggccgacctgatcttcgcctcgggcggcggcattttcggccaccccgacggcctg
gccgccggctgcgccagcctgcgccaggcctgggaggccgccatcgccggccaggaactg
cgcgcctatgcgcagtcgcgccccgaactggccgcggcgctggcgcgcggcaaacccgtg
cgcaaggcctga

DBGET integrated database retrieval system