KEGG   Bordetella bronchiseptica RB50: BB1807Help
Entry
BB1807            CDS       T00141                                 

Gene name
goaG
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00250  Alanine, aspartate and glutamate metabolism
bbr00410  beta-Alanine metabolism
bbr00640  Propanoate metabolism
bbr00650  Butanoate metabolism
bbr01100  Metabolic pathways
bbr01120  Microbial metabolism in diverse environments
Module
bbr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BB1807 (goaG)
   00650 Butanoate metabolism
    BB1807 (goaG)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BB1807 (goaG)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BB1807 (goaG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bbr01007]
    BB1807 (goaG)
Enzymes [BR:bbr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BB1807 (goaG)
Amino acid related enzymes [BR:bbr01007]
 Aminotransferase (transaminase)
  Class III
   BB1807 (goaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CAE32304
GeneDB: BB1807
UniProt: A0A0H3LTV8
LinkDB All DBs
Position
complement(1907339..1908604)
Genome map
AA seq 421 aa AA seqDB search
MKNRDLNTRRTLATPRGVGVMCDFYAVRAENSTLWDAEGKEYIDFAGGIAVLNTGHRHPK
VKAAIAAQLDNFTHTAYQIVPYEGYVSLAERINAVAPIEGLKKTAFFTTGVEAVENAVKI
ARAYTGRSGVVAFSGAFHGRTMMGMALTGKVAPYKLAFGPMPGDVFHVPFPNATQAISVA
DSLKALDLLFKVDIDPKRVAAIIIEPVQGEGGFNVTPPELMQALRKVCDEHGILLIADEV
QTGFARTGKLFAMQHHSVQADLITMAKSLGGGMPISGVVGRAEVMDGPAAGGLGGTYAGN
PLAVAAAHAVLDVIAEEKLCERAAELGKRLMDRLEGLRAKCPAIADVRGLGSMVALELND
PATGKPDAEAVKRIQQQAIERGLILLSCGVYGNVLRFLYPLTIPDDQFARALDILAETIA
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccgagatctgaatacgcgtcgtacgctggccaccccgcgcggcgtcggcgtg
atgtgtgacttttacgccgtgcgggcggaaaactcgaccctgtgggatgccgagggcaag
gagtacatcgacttcgccggcggcatcgcggtgctgaacaccggccatcgccatcccaag
gtcaaggccgccatcgccgcccagctggacaacttcacccacaccgcctaccagatcgtg
ccgtacgagggctacgtatcgctggccgagcgcatcaacgccgtggccccgatcgaaggc
ctgaagaagaccgccttcttcaccaccggcgtcgaggcggtggaaaacgccgtcaagatc
gcccgcgcctacaccggccgctcgggcgtggtggcgttctcgggcgcgttccatggccgc
accatgatgggcatggccctgaccggcaaggtcgcgccctacaagctggcgttcggcccg
atgccgggcgacgtgttccacgtaccgttccccaacgccacgcaggccatcagcgtggcc
gactcgctcaaggccctggacctgctgttcaaggtcgacatcgatcccaagcgcgtggcc
gccatcatcatcgagccggtgcaaggcgaaggcggcttcaacgtcacgccgcccgaactg
atgcaggcgctgcgcaaggtctgcgacgagcacggcatcctgctgatcgccgacgaagtg
cagaccggcttcgcgcgcaccggcaagctgttcgccatgcagcaccattcggtacaggcc
gacctgatcaccatggccaagagcctgggcggcggcatgccgatctcgggcgtggtgggc
cgcgccgaagtcatggacggcccggccgccggcggcctgggcggcacctacgccggcaac
ccgctggccgtggccgccgcgcacgcggtgctggacgtgatcgccgaggaaaaactgtgc
gagcgcgccgccgaactgggcaagcgcctgatggaccgcctggaaggcctgcgcgccaag
tgcccggccatcgccgacgtgcgcggcctgggttcgatggtcgcgctggagctgaacgac
ccggccaccggcaagcccgacgccgaggcggtcaagcgcatccagcagcaagccatcgag
cgcggcctgattttgctaagctgcggtgtgtacggaaacgttctgcgtttcctgtatccc
ctgaccatccccgatgaccagttcgctcgcgcgctggacatcctggccgaaaccatcgcc
gcctga

DBGET integrated database retrieval system