KEGG   Bordetella bronchiseptica RB50: BB2422Help
Entry
BB2422            CDS       T00141                                 

Gene name
aroG
Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase, Phe-sensitive
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01130  Biosynthesis of antibiotics
bbr01230  Biosynthesis of amino acids
bbr02024  Quorum sensing
Module
bbr_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bbr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BB2422 (aroG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BB2422 (aroG)
Enzymes [BR:bbr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     BB2422 (aroG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 Cellulase-like
Motif
Other DBs
NCBI-ProteinID: CAE32916
GeneDB: BB2422
UniProt: A0A0H3LSS9
LinkDB All DBs
Position
complement(2575343..2576461)
Genome map
AA seq 372 aa AA seqDB search
MTRIDDPLHDREAGQADATQDTTRIDDVRIGAVRPLISPALLQDELPVSAPLQALVEDSR
ARIADVLHGRDDRLVVVVGPCSIHDHEQAMEYARQLKEAADTLADDLLIVMRVYFEKPRT
TVGWKGYINDPRLDGSFRINEGLRRARHLLLEIGALGLPIATEFLDLLSPQYIADLIAWG
AIGARTTESPSHRQLASGLSCPLGFKNGTDGGIQVAADAIVAASAPHAFMGMTKMGTAAI
FETRGNDDTHVILRGGKQGPNYDAAAIDACCAALAKAGLREQVMVDCSHANSNKSHARQV
DVARDLARQLAGGDRRIIGIMIESNLEEGRQDLKPGVPLKRGVSITDACLSWAQTEPVLA
ELAQAVRQRREG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
ttgacccgtatcgatgacccgctgcacgatcgcgaggccggccaggccgacgcgacgcaa
gacaccacccgcatcgacgacgtgcgcatcggcgccgtgcgtcccctgatttcgcccgcc
ctgctgcaggacgaactgccggtatcggcgccgctacaggcgctggtcgaggacagccgc
gcgcgcatcgccgacgtgctgcacggccgcgacgaccggctggtggtggtggtcggcccc
tgctccatccacgaccacgaacaggccatggagtacgcgcgccagctcaaggaggcggcc
gacacgctggccgacgacctgctcatcgtcatgcgcgtgtacttcgagaagccgcgcacc
accgtgggctggaagggctacatcaacgatccgcgcctggacggcagtttccgcatcaac
gaaggcctgcgccgcgcgcgccacctgctgctggaaatcggcgccctgggactgcccatc
gccaccgaattcctggacctgctcagcccgcaatacatcgccgacctgatcgcctggggc
gcgatcggcgcgcgcaccaccgaaagccccagccaccggcaactggcctcgggcctgagc
tgcccgctgggtttcaagaacggcaccgacggcggcatccaggtggcggctgacgccatc
gtggccgccagcgccccgcatgccttcatgggcatgaccaagatgggcaccgccgccatc
ttcgagacgcgcggcaacgacgacacccacgtcatcctgcgcggcggcaagcaaggcccc
aactacgacgcggccgccatcgacgcctgctgtgcggcgctggccaaggccggcctgcgc
gagcaggtcatggtcgactgctcgcacgccaattcgaacaagtcgcacgcgcgccaggtc
gacgtggcgcgcgacctggcccggcagctggccggcggcgaccgccgcatcatcggcatc
atgatcgaaagcaacctcgaggaaggccgccaggatctcaagcccggcgtgccgctcaag
cgcggcgtgtccatcaccgacgcctgcctgagctgggcccagaccgagccggtgctggcc
gagctggcccaggccgtgcgccagcgccgcgaaggctga

DBGET integrated database retrieval system