KEGG   Bordetella bronchiseptica RB50: BB2845Help
Entry
BB2845            CDS       T00141                                 

Definition
(GenBank) Putative ATP-dependent DNA-ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bbr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BB2845
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bbr03400]
    BB2845
Enzymes [BR:bbr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BB2845
DNA repair and recombination proteins [BR:bbr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BB2845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: CAE33337
GeneDB: BB2845
UniProt: A0A0H3LN90
LinkDB All DBs
Position
3008333..3010795
Genome map
AA seq 820 aa AA seqDB search
MTQPLRQYREKRDFRATAEPAGAARRPRAAARASEGLSFVIQRHQARRLHYDFRLEIDGV
LVSWAVPKGPSRDPSVKRLAVHVEDHPLEYGGFSGDIPKGQYGAGHVDIWDSGVWIPRGD
PRQGLRRGKLHFALRGRRLAGDWVLVRMSGEQDQWLLRKEDDEAAVPGDDAERAPATPPP
APEHAPAATPRGRRAAMPHTLAPQLATLVDSPPHGPGWSYEVKYDGYRILAACSAGGVRL
VSRGNEDWQARMAPLARALGALKLGRGWLDGEVVVLDERGVADFQLLQNALDGQAEGLVF
VAFDLPFWNGEDLRALPLQARQERLEDLLREVPEDAPLMLTQRLPVADDTEGKAAWNEAC
RLSLEGLICKRLDAPYRSGRSQGWLKLKCRPRQEFVIGGYTEPAGARRHLGALLVGLRQG
RQLRYAGRVGTGFGAATLRTLGQRLAALRQDAKPFSGDVPRGRGDAAIHWVSPELVAEVN
YAGITRDGLLRQASFAGLRADKPASEVRGEVAARPPAAKAATPSRRAGDGRAEVAGVRIS
HPDRLAYREPDYTKLQLAEYYAAIGPHILPHLRQRRVALLRCPDGAGTTCFFQKHLSQSL
PAGVRRDGGHLVIESLPGLIALVQYGAIEFHTWGADTRHPDTPDRITLDLDPGPGVAWPA
IVEGAQMARLLMQEVGLEPFLKTTGGKGLHLVAPLRPTQPWDTVKDFARALARQLAVALP
DRFTANMAKARRERRIFVDYLRNGNGATAVAAFSARARDGAPVSMPLSWDALDAGDDLRG
ARWNIANALEQARRKPDPWADYAASRRTLGSRMQARLPRD
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgacacagccactgcggcagtaccgcgagaagcgcgatttccgcgccaccgccgaaccg
gccggcgccgcccggcgcccgcgcgcggccgcccgcgcaagcgaaggcctgtccttcgtc
atccagcgccatcaggcgcgccgcctgcattacgatttccgtctcgaaatcgacggcgtg
ctggtgagctgggcggtgcccaagggcccgtcgcgcgatccttccgtcaagcgcctggcc
gtgcatgtggaagaccatccgctcgagtatggcggattctccggcgacattcccaagggc
cagtacggcgccggacatgtcgacatctgggacagcggcgtctggatcccgcgcggcgat
ccgcgccagggcttgcggcgcggcaagctgcatttcgcgttgcgcggccggcgtcttgcc
ggcgactgggtcctggtgcgcatgagcggcgagcaggaccaatggctgctgcgcaaggaa
gacgacgaggcggcggtgccgggcgatgacgccgaacgcgcgccggccaccccgccgccc
gccccggagcacgccccggcggccacgccgcgcgggcgccgcgccgcgatgccgcacacg
ttggcgccccagctggccacgctggtggacagcccgccgcatgggccgggctggtcgtat
gaggtcaagtacgacggctaccgcatcctggcggcctgctcggccggcggcgtgcgcctg
gtcagccgcggcaacgaggattggcaggctcgcatggcgccgctggcgcgcgcgctgggc
gcgctgaagctggggcgcggctggctcgacggcgaggtcgtcgtgctcgacgaacgcggc
gtggccgatttccagctgttgcagaatgcgctggacggccaggccgaagggctggtgttc
gtcgcgttcgaccttcccttctggaatggcgaggacctgcgcgccctgcccctgcaagcc
aggcaagagcggctcgaggacctgctgcgggaggtgcccgaggacgcgccgctgatgctc
acgcaacgcctgccggtggccgacgacaccgaaggcaaggcggcctggaacgaagcctgc
cggctgagcctggaaggcctgatctgcaagcgcctggacgcgccttaccggtccggccgc
tcgcagggctggctgaagctgaagtgccgcccgcgccaggaattcgtcatcggcggctat
accgaaccggccggcgcgcgccgccacctgggcgccttgctggtgggcctgcgccaaggc
cgccaattgcgctatgcgggccgcgtggggacgggcttcggcgcggccacgctgcgcacg
ctgggccagcggctggcggcgctgcgccaggatgccaagccgttttcgggcgacgtgccg
cgcggccgcggcgacgccgccatacattgggtcagccccgagctggtggccgaagtgaat
tatgcgggcatcacgcgcgacggcctgctgcgccaggcttcgtttgccggcctgcgcgcc
gacaagcccgccagcgaagtgcgcggcgaggtggccgcgcggccgccggcggccaaggcc
gccacgccgtcgcgccgcgccggcgatggccgcgccgaggtggccggcgtgcgcatctcg
catccggaccggctggcctatcgcgagcccgactacaccaagttgcagctggccgagtac
tacgcggccatcggcccgcatatcctgccgcacctgcgccagcgccgcgtggccctgttg
cgctgtcccgacggcgccggcacgacctgcttcttccagaagcacctgagccagtcgctg
cctgccggcgtgcggcgcgacggcgggcacctggtgatcgaatcgctgcccggcctgatc
gcgctggtgcagtatggcgccatcgagttccatacctggggcgccgatacccgccatccc
gacacgcccgaccggatcaccctggacctggaccccggccccggcgtggcgtggccggcc
attgtcgaaggcgcgcagatggcccgcctgctgatgcaggaagtcgggctggaacctttt
ctcaagacgaccggcggcaagggcctgcacctggtggcgccgctgcggcccacgcagccc
tgggacacggtcaaggatttcgcgcgcgcgctggcgcgccagctggccgtggccctgccc
gaccggttcaccgccaacatggccaaggcccggcgcgaacggcgcatcttcgtggactac
ctgcgcaacggcaacggcgccaccgcggtggccgcgttctcggcgcgggcgcgcgacggc
gcgcccgtttccatgccgctgtcctgggacgcgctggacgccggcgacgatttgcgcggc
gcgcgctggaacatcgccaacgcgctggagcaggcccggcgcaagcccgacccctgggcc
gattatgccgccagccggcgcacgctgggttcgcgcatgcaggcgcggctgccgcgcgat
tga

DBGET integrated database retrieval system