KEGG   Bordetella bronchiseptica RB50: BB3060Help
Entry
BB3060            CDS       T00141                                 

Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00564  Glycerophospholipid metabolism
bbr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BB3060
Enzymes [BR:bbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BB3060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 HI0933_like Pyr_redox_2 GIDA FAD_binding_3 NAD_binding_8 Pyr_redox Pyr_redox_3 Thi4
Motif
Other DBs
NCBI-ProteinID: CAE33552
GeneDB: BB3060
UniProt: A0A0H3LUH8
LinkDB All DBs
Position
3266173..3267777
Genome map
AA seq 534 aa AA seqDB search
MTAPTLAPIDPPARAQLLADLQGAPDWDVIVIGGGATGLGTAVDAAARGYRTLLVEAADF
AKGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLNRNAPHLVWPLGFVVPAYSLLDQ
PFYGVGLKMYDMLAGKLNLAPSRWLSRGETLRHAATVAERVNGRALRGGILYYDGQFDDA
RLAIALMRTLYDLGGVALNYARAVGLTRTDGRVDGVTVADALGELRVTLRAKCVVNATGV
WVDAVRRMDDPAAQTMVAPSQGVHLTLPRDFLPGEDAILIPKTDDGRVLFVVPWNGHTIV
GTTDTPRTDLPLDPQAGQNEIDFILATAARYLSRKPTRADVTSVWAGLRPLVKATGEAST
KSLSREHTIVVSKGGLVTVTGGKWTTYRKMAQDVVDTAIQHKLLAAAPCRTSELPLHGAP
TDGQPNGAPHGTPDSYYGTDLATLRALPGADRMLVKASALTEAHVRYAARHELARTVEDV
LARRNRALFLDAEAALLAAPEVARILAQELGHDEAWSRATLAEFEAVAAHYRLA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccctaccctcgctcccatcgacccgcccgcgcgcgcgcaactgcttgccgac
ctgcaaggcgcccccgattgggatgtcatcgtcatcggcggcggcgccaccggcctgggc
accgccgtcgatgccgccgcgcgcggctaccgcaccctgctggtcgaggccgccgacttc
gccaagggtacctccagcaaggccaccaagctggtgcacggcggcgtgcgctacctggcg
cagggcaatatcagcctggtgcgcgaggccctgcacgaacgcggcctgctcaaccgcaac
gcgccgcacctggtgtggccgctgggcttcgtcgtgccggcctacagcctgctggaccag
ccgttctacggcgtcggcctgaagatgtacgacatgctggccggcaagctgaacctggcg
cccagccgctggctgtcgcgcggcgaaacgctgcgccacgccgccaccgtggccgagcgc
gtcaatggacgagccttgcgcggcggcatcctgtactacgacggccagttcgacgacgcg
cgcctggccatcgccctgatgcgcaccctgtacgacctgggcggcgtggcgctgaactat
gcgcgcgcggtcggcctgacgcgcacggacggccgcgtcgacggcgtgacggtggccgac
gcgctgggcgagctgcgcgtgacgctgcgcgccaaatgcgtggtcaacgccaccggcgtg
tgggtcgacgcggtgcgccgcatggacgaccccgccgcgcagaccatggtggcgcccagc
cagggcgtgcacctgacgctgccgcgcgacttcctgcccggcgaagacgccattctcata
cccaagaccgacgacggccgagtgctgttcgtggtgccctggaacggccacaccatcgtc
ggcaccaccgacacgccacgcaccgacctgccgctcgatccgcaggccggccagaacgaa
atcgacttcatccttgccaccgcggcgcgctacctgagccgcaagcccacccgcgccgac
gtgaccagcgtgtgggccggcctgcgcccgctggtcaaggccaccggcgaagcctcgacc
aagtcgctgtcgcgcgaacacaccatcgtggtctccaagggcgggctggtcacggtcacc
ggcggcaaatggaccacctaccgcaagatggcccaggatgtggtcgacaccgccatccag
cacaagctgctggccgcggcgccatgccgcacgtccgagctgccgctgcatggcgcgccg
accgacgggcagcccaacggcgcgccccacggcacgcccgacagctactacggcaccgac
ctggcgacgctgcgcgcgctgcccggcgccgaccgcatgctggtcaaggccagcgccctg
accgaggcgcacgtgcgctatgccgcccgccacgaactcgcgcgcaccgtggaggacgtg
ctggcccgccgcaatcgcgccctgttcctggacgccgaggccgccctgctggccgcgccc
gaagtggcccgcatcctggcgcaggaactcggccacgacgaagcctggagccgcgccacg
ctggccgagttcgaggccgtggccgcgcactaccggctggcctga

DBGET integrated database retrieval system