KEGG   Bordetella bronchiseptica RB50: BB3679Help
Entry
BB3679            CDS       T00141                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00020  Citrate cycle (TCA cycle)
bbr00190  Oxidative phosphorylation
bbr00650  Butanoate metabolism
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01120  Microbial metabolism in diverse environments
bbr01130  Biosynthesis of antibiotics
bbr01200  Carbon metabolism
Module
bbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bbr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BB3679 (sdhB)
   00650 Butanoate metabolism
    BB3679 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BB3679 (sdhB)
Enzymes [BR:bbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BB3679 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BB3679 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-ProteinID: CAE35652
GeneDB: BB3679
UniProt: A0A0H3LU54
LinkDB All DBs
Position
complement(3897912..3898628)
Genome map
AA seq 238 aa AA seqDB search
MSTKRIVKFEIYRYDPDKDERPYMQKLEVELQPTDKMLLDALVRIKNDVDDSLALRRSCR
EGVCGSDAMNINGKNGLACTTNLLELKEPIVLKPLPGLPVIRDLIVDMTHFFNQYHSIRP
YLINDTPPPEKERLQSPEAREELDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLQAYR
FIADSRDEATGARLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRTV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagcactaaacgaatcgttaagttcgaaatctaccgctacgatcctgacaaggacgag
cgtccgtacatgcagaagctggaagtcgaactccagccgaccgacaagatgcttctcgat
gcgctggtgcgcatcaagaacgacgtggacgacagcctggcgctgcgccggtcgtgccgc
gagggcgtgtgcggttcggatgccatgaacatcaacggcaagaacggcctggcctgcacc
accaacctgctggagctgaaggaacccatcgtcctgaagccgttgcccggcctgcccgtg
atccgcgacctgatcgtggacatgacgcacttcttcaatcagtaccactcgatccgcccc
tacctcatcaacgacacgccgccgcccgagaaagagcgcctgcagtcgcccgaggcgcgc
gaggaactcgatggcctgtacgagtgcatcctgtgcgcgtgctgctcgacgtcgtgcccg
tcgttctggtggaacccggacaagttcgtcggcccggccggcctgctgcaggcctaccgc
ttcatcgccgacagccgcgacgaagcaaccggtgcccgcctggacaacctggaggatccg
taccgcctgttccgctgccacaccatcatgaactgtgtcgacgtctgtcccaagggtctc
aatccgaccaaggcgatcggcaagatcaaggaactgatggtccgtcgtacggtctag

DBGET integrated database retrieval system