KEGG   Bordetella bronchiseptica RB50: BB3680Help
Entry
BB3680            CDS       T00141                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00020  Citrate cycle (TCA cycle)
bbr00190  Oxidative phosphorylation
bbr00650  Butanoate metabolism
bbr01100  Metabolic pathways
bbr01110  Biosynthesis of secondary metabolites
bbr01120  Microbial metabolism in diverse environments
bbr01130  Biosynthesis of antibiotics
bbr01200  Carbon metabolism
Module
bbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bbr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BB3680 (sdhA)
   00650 Butanoate metabolism
    BB3680 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BB3680 (sdhA)
Enzymes [BR:bbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BB3680 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BB3680 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA HI0933_like Thi4 FAD_binding_3 Lycopene_cycl Pyr_redox_3 NAD_binding_7 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CAE35653
GeneDB: BB3680
UniProt: A0A0H3M136
LinkDB All DBs
Position
complement(3898641..3900419)
Genome map
AA seq 592 aa AA seqDB search
MVAVMNSLPRRQFDVVVVGAGGAGMRCSLQLAQAGLSVAVLSKVFPTRSHTVAAQGGVSA
SLGNMSEDNWYWHMYDTVKGSDWLGDQDAIEFMCREAPNAVYELEHFGMPFDRNADGTIY
QRPFGGHTANFGEKPVQRACAAADRTGHALLHTLYQRNVAARTQFFVEWMALDLLRNEAG
DVLGVTALEMETGEIYVLEAKTTVLATGGAGRIWAASTNAFINTGDGLGMAARAGIPLQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILLNKDGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGCGPDGSYVVLKLDHLGADVINKRLPSIREIAIKFGNVDPIKEPIPVVPTIHYQ
MGGIPANYHGQVLERANGENKIVNGLYAIGECAAVSVHGANRLGTNSLLDLIVFGRATGN
HIVDSHPERQHAHQPLPKEAVDRSLARVDELESRTSGEKTQDVANAIRMSMQRHCGVFRT
LELLNEGVGQIEDLAQTAQHIYFKDKSKVFNTARVEALELANMTEVARATIKSAANRTES
RGAHALNDHPERDDVNWLKHTLWYSEGSRLDYKPVQMKPLTVESFPPKARTF
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgctgtcatgaattccttgccgcgccgccagtttgatgtggtggtggtcggcgcc
ggcggagccggcatgcgctgttcgctgcaactggcccaggcgggcctgtcggttgcggtg
ctgtccaaagtgttcccgacccgttcgcacacggttgccgcgcaaggcggcgtgagcgcg
tcgctgggcaacatgagcgaagacaactggtactggcatatgtacgacaccgtcaagggg
tcggactggctgggcgatcaggatgccatcgagttcatgtgccgcgaggcgcccaatgcc
gtgtatgagctcgagcacttcggcatgccgttcgaccgcaacgccgacggcaccatctac
cagcgtccgttcggcggccatacggccaatttcggcgagaagccggtgcagcgcgcctgt
gccgccgccgaccgtaccggccacgcgctgctgcacacgctctaccagcgcaacgtcgcc
gcccgtacccagttcttcgtcgagtggatggcgctggacctgctgcgcaacgaagccggc
gacgtgctgggcgtgaccgcgctcgaaatggaaaccggcgagatctacgtcctggaagcc
aagaccacggtgctggccaccggcggcgccggccgtatctgggccgcttccacgaacgcc
ttcatcaacaccggcgacggcctgggcatggcggcgcgcgcgggcatcccgctgcaggac
atggagttctggcagttccacccgaccggcgtggccggcgcgggcgtgctgatcaccgaa
ggcgtgcgcggcgaaggcggcatcctgctcaacaaggatggcgagcgcttcatggagcgc
tacgcgcccacgctgaaggacctggcgccgcgcgacttcgtgtcgcgctcgatggaccag
gaaatcaaggaaggccgcggctgcggtcccgacggcagctacgtggtgctgaagctggat
cacctcggcgccgacgtgatcaacaagcgcctgccgtcgatccgtgagatcgccatcaag
ttcggcaacgtcgacccgatcaaggaaccgatccccgtcgtgccgaccatccactaccag
atgggcggcattcccgccaactaccacggccaggtgctcgagcgcgccaacggcgagaac
aagatcgtcaacggcctgtacgccatcggcgaatgcgccgcggtgtcggtgcacggcgcc
aaccgcctgggcaccaattcgctgctggacctgatcgtcttcggccgtgccaccggcaac
catatcgtcgactcgcatcccgagcgccagcacgcccaccagccgctgcccaaggaagcc
gtcgaccggtcgctggcgcgcgtcgacgagctggagtcgcgcacttcgggcgagaagacc
caggacgtcgccaacgccatccgcatgtcgatgcagcgccattgcggcgtgttccgcacg
ctggagctgctcaacgagggcgtgggccagatcgaagacctggcgcagacggcccagcac
atctacttcaaggacaagtcgaaggtgttcaacaccgcgcgcgtcgaggcgctggaactg
gccaacatgaccgaggtggcgcgcgccaccatcaagtcggccgccaaccgcaccgaaagc
cgcggcgcgcatgcgctgaacgaccatcccgagcgcgacgacgtgaactggctcaagcat
acgctgtggtattcggaaggcagccgcctcgactacaagcccgttcagatgaagccgctg
acagtggaatccttcccgcccaaggctcgtactttctaa

DBGET integrated database retrieval system