KEGG   Bordetella bronchiseptica RB50: BB4129
Entry
BB4129            CDS       T00141                                 

Definition
(GenBank) putative hydrolase
  KO
K10216  2-hydroxymuconate-semialdehyde hydrolase [EC:3.7.1.9]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00362  Benzoate degradation
bbr00622  Xylene degradation
bbr00643  Styrene degradation
bbr01100  Metabolic pathways
bbr01120  Microbial metabolism in diverse environments
bbr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bbr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BB4129
   00622 Xylene degradation
    BB4129
   00643 Styrene degradation
    BB4129
Enzymes [BR:bbr01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.9  2-hydroxymuconate-6-semialdehyde hydrolase
     BB4129
SSDB
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 BAAT_C Ndr AXE1
Other DBs
NCBI-ProteinID: CAE34492
GeneDB: BB4129
UniProt: A0A0H3LYQ6
LinkDB
Position
4393809..4394624
AA seq 271 aa
MDRKQTTFNGLRVAYWEGGSGEPLLLIHGSGPGASTLGNWRLVLDELARDFHVIAPDLIG
FGQSDRKPEAPYFDLDLWAVQAKAALDLFDSARINVLGHSLSGYLALRLASEDARVRAVM
TTGAMGVPFPLNDDLERTWSFPPTREAIVRAGESLVYDRDVLTEAYVQGRVDVLHQGDYG
AYFSAMFAGDKQQYIDAAVLPAQAWGRIQCPVMLVHGRNDLPIPFERSALEIARRLPHAD
LVALAHCGHSPALEHPGKLAALARLFFHPAP
NT seq 816 nt   +upstreamnt  +downstreamnt
atggaccgaaagcaaaccaccttcaacggactgcgcgtggcctattgggagggaggaagc
ggagagccgctgcttctgattcacggctccgggccgggcgcatccacgctgggcaactgg
cggctcgtcctggacgaactggcccgggatttccacgttatcgcgccagacctgatcgga
ttcgggcagagcgaccgcaagcccgaggccccgtatttcgatctcgacctgtgggccgtc
caagccaaggcagcgctggatctgtttgacagcgcccggatcaacgtcctggggcattcc
ctttccggctacctggccttgcggctggccagcgaggatgcgcgcgtgcgcgccgtcatg
acgaccggggcgatgggcgtgccatttcccttgaatgacgacttggaaagaacctggtca
ttccccccgacccgcgaggcgatcgtgcgggcaggcgaatcgctggtctatgaccgcgac
gtactgaccgaggcctacgttcagggccgcgtcgacgttttgcaccagggggattacggc
gcgtatttcagcgcgatgttcgccggcgacaagcagcagtacatcgacgccgccgtgctg
cccgcccaggcgtggggacgcatccagtgccccgtcatgctcgtgcacggccgcaacgat
ctgccgatcccgttcgaacgaagcgcgctggaaattgcccgccgcctgccgcatgccgat
ctcgttgcactggcgcattgcgggcactcccccgccctggagcatcccggcaagctggcc
gccctcgcgcgccttttctttcatccggcgccgtag

DBGET integrated database retrieval system