KEGG   Bordetella bronchiseptica RB50: BB4643Help
Entry
BB4643            CDS       T00141                                 

Definition
(GenBank) probable aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BB4643
Enzymes [BR:bbr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BB4643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC RbcS DUF4375
Motif
Other DBs
NCBI-ProteinID: CAE35005
GeneDB: BB4643
UniProt: A0A0H3LR67
LinkDB All DBs
Position
complement(4941493..4942953)
Genome map
AA seq 486 aa AA seqDB search
MEDLRNHEFKNYIGGQWVACAAGKTYPNVNPADTDDIVGRFQASQAEDAAAAVAAAQAAF
DGWRNLAVSKRAALMQRAADYLEAHAEQFGRELTREEGKALNLAKDEVLRSAQTIRFYAA
EGQSFSGETFVNDDPDMVVYSQREPLGVVTVISPWNFPVSIPARKIAPALITGNTVVFKP
SSDAPLSGLRLVEAFEQAGLPPGVLNLVTGSASAIGAAITQAPQVRAVSFTGSTAAGEQI
HRSVDMTTRTQMELGGKNPLIVMADADLDRAVDLVVKGGFSLSGQACTGTSRVLVDAPVK
AAFTEKLLAKVKALKVGNSLEGSFDLGPLATARQLESVMRYIEVGKQEARLLYGGERLDG
PGYERGYYLTPAVFADVTQQMRIAREEIFGPVIALIEVNGYEDAIAKANDTEYGLAAAIA
TTNAQYAHRFARDIQAGTVKINRTTTGNLINAPFGGLKRSSTSTFRESGRIGLEFYTQIK
TVYRAG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtggaagatctccggaaccacgagttcaagaactatatcggcgggcaatgggtcgcctgc
gccgcgggcaagacctatcccaacgtaaacccggccgacaccgacgacatcgtggggcgc
ttccaggcctcgcaggccgaggatgcggccgcggcggtggccgccgcgcaggccgccttc
gacggttggcgcaacctggccgtgtccaagcgcgccgcgttgatgcagcgcgccgccgac
tacctggaggcgcacgccgagcagttcggccgcgagctgacgcgcgaggaaggcaaggcg
ctgaacctggccaaggacgaagtcctgcgctcggcgcagaccatccgcttctacgcggcc
gagggccagtcgttcagcggcgagaccttcgtcaacgacgatccggacatggtcgtgtac
agccagcgcgagccgctgggcgtggtgacggtgatctcgccgtggaacttcccggtgtcg
atcccggcgcgcaagatcgccccggcgctgatcaccggcaataccgtggtgttcaagcct
tcctcggatgcgccgctgtccggcctgcgcctggtcgaggcgttcgagcaggcgggcctg
ccgcccggggtgctgaacctggtgaccggcagcgcctcggccatcggcgcggcgatcacc
caggcgccgcaggtgcgcgcggtgtcgttcaccggctcgaccgcggcgggcgagcagatc
caccgctcggtggacatgaccacccgcacgcaaatggagctgggcggcaagaacccgctg
atcgtcatggccgatgccgacctggaccgcgccgtggacctggtcgtcaagggcggtttt
tcgctcagcggccaggcctgcacgggaaccagccgcgtgctggtggacgcgccggtcaag
gcggccttcaccgagaagctgctggccaaggtcaaggccctgaaagtgggcaacagcctg
gaaggcagtttcgacctgggtccgctggccaccgccaggcagctcgaatcggtgatgcgc
tacatcgaggtgggcaagcaggaggcccggctgctgtatggcggcgagcggctggacggt
ccgggctacgaacgcggctactacctcaccccggcggtctttgccgacgtcacgcagcag
atgcgcatcgcccgcgaggagatcttcgggccggtcatcgcgctgatcgaggtcaatggc
tatgaagacgccatcgccaaggccaacgacaccgagtacggcctggccgcggccatcgcc
accaccaatgcgcagtacgcgcaccgtttcgcgcgcgatatccaggccggcacggtgaag
atcaaccgcaccaccacgggcaacctgatcaatgcgccgttcggcggcctgaagcgctcc
agcacctcgacgttccgcgagtcgggccgcatcgggctggagttctatacccagatcaag
acggtctaccgcgccggctga

DBGET integrated database retrieval system