KEGG   Bordetella bronchiseptica RB50: BB4729Help
Entry
BB4729            CDS       T00141                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
bbr  Bordetella bronchiseptica RB50
Pathway
bbr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bbr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BB4729
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbr02000]
    BB4729
Transporters [BR:bbr02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BB4729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_22 AAA_21 AAA_16 AAA_29 Mg_chelatase AAA_23 RsgA_GTPase ATP-synt_ab AAA_24 NACHT AAA_18 MeaB
Motif
Other DBs
NCBI-ProteinID: CAE35092
GeneDB: BB4729
UniProt: A0A0H3LRF0
LinkDB All DBs
Position
5030653..5032344
Genome map
AA seq 563 aa AA seqDB search
MTATHPASSAAPLLSIQDLSIALPAGGDRPYAVRNISFDINAGEILCIVGESGSGKSMSA
NAIMGLLPHYLRPEGGRILFDNRDLLSLDESTLRGMRGREMAMIFQEPLSALNPLLTVGE
QIEEVMRVHNAYPEQERAQRVLDVLEFVGLPEPRLIRHAWPFRLSGGQRQRVMIAMALVL
EPRLLIADEPTTALDVTTQAQILELIARIQRQKGMGVMFVTHDFGVVAEIADRVAVMEKG
ILVEEGTADQVLNRPRHPYTQRLIAAVPTQRTGGDASPAAAFSPVLHVRNLKKTYAAAGG
LFHKKRVVHAVNDVSFTVGRGQTVGIVGESGSGKSTIGKCLLKLIDIDGGQMLFEGKDIA
PLTEAQFRPQRRKIQMIFQDPFASLNPRHTVGRILCDGPMAGGTPRQQAEKRARELLRLV
ELDPSAFDRYPGEFSGGQRQRIGIARALAMDPQLIVADESVSALDVSVQAQVLKLLREVQ
QRLQLALIFITHDLRVASQICDHLLVMHRGKVVEQGPPTQIFDDPQDPYTRQLIAAMPGR
DWDPAAAALAQAADEPALYPQPC
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
gtgacagctacccatccagcctcgtccgccgcgccgctgctttccatccaggacctcagc
atcgcgctgcccgccggcggcgaccgcccgtatgcggtccgcaatatctcgttcgacatc
aacgcgggagaaatcctctgcatcgtcggcgaatccggctcgggcaaatccatgagcgcc
aacgccatcatgggcctgctgccgcactacctgcgccccgagggcggacgcatcctgttc
gacaaccgcgacctgctctcgctggacgaatccacgctgcgcggcatgcgcgggcgcgaa
atggccatgatcttccaggaaccgctgtcggcgctgaacccgctgctgaccgtcggcgag
cagatcgaggaagtcatgcgcgtgcacaacgcctatccagagcaggagcgcgcgcagcgc
gtgctcgacgtgctggagttcgtcggcctgcccgagccccggctgatccggcacgcctgg
cctttccgcctgtccggcggccagcgccagcgcgtcatgatcgccatggcgctggtgctc
gaaccccggctgctgatcgccgacgagcccaccaccgcgctggacgtcacgacccaggcg
cagatcctcgaactgatcgcccgcatccagcgccagaaaggcatgggcgtgatgttcgtc
acccacgacttcggcgtggtggccgaaatcgccgaccgcgtggcggtgatggaaaaaggc
atcctggtcgaggaaggcacggccgaccaggtgctcaaccggccgcgccatccgtacacg
cagcggctgatcgccgcggtgcccacccagcgcaccggcggcgacgcaagcccggccgcg
gcgttcagcccggtgctgcatgtgcgcaacctgaagaagacctacgccgccgccggcggg
ctgttccacaagaagcgcgtcgtgcacgccgtcaatgacgtcagcttcaccgtgggacgc
ggccagacggtcggcatcgtgggcgaatcgggttcgggcaaatccaccatcggcaagtgc
ctgctcaagctgatcgacatcgacggcggccagatgctgttcgaaggcaaggacatcgcg
cccctgaccgaggcgcagttccggccgcagcggcgcaagatccagatgatcttccaggat
ccgttcgcctcgctcaacccgcgccacacggtgggccgcatcctgtgcgacggccccatg
gcgggcggcacgccgcgccagcaggccgaaaagcgcgcgcgcgaattgctcaggctggtc
gagctggatccgtccgccttcgaccgctatccgggcgaattctccggcggccagcgccag
cgcatcggcatcgcgcgcgcgctcgccatggacccgcagctgatcgtggccgacgaatcg
gtctcggccctggacgtatcggtgcaggcccaggtgctcaagctgctgcgcgaggtccag
cagcgcctgcagctggcgctcatcttcatcacgcacgacctgcgcgtggcctcgcagatc
tgcgaccacctgctggtcatgcatcgcggcaaagtggtcgagcaggggccgcccacgcag
atcttcgacgacccgcaggacccctacacgcgccagctgatcgccgccatgcccgggcgc
gactgggatcccgcggccgccgcgctcgcgcaggccgccgacgaacccgccctgtaccca
cagccatgctga

DBGET integrated database retrieval system