KEGG   Bifidobacterium breve JCM 7019: B7019_0043Help
Entry
B7019_0043        CDS       T03121                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bbrc  Bifidobacterium breve JCM 7019
Pathway
bbrc00620  Pyruvate metabolism
bbrc00680  Methane metabolism
bbrc01100  Metabolic pathways
bbrc01120  Microbial metabolism in diverse environments
bbrc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbrc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B7019_0043
  09102 Energy metabolism
   00680 Methane metabolism
    B7019_0043
Enzymes [BR:bbrc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B7019_0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHJ18387
UniProt: W6F6E7
LinkDB All DBs
Position
complement(55178..57931)
Genome map
AA seq 917 aa AA seqDB search
MATPEEQITPADAAIVTTGTGRKGPEEHDLPQNLKYDMDLCLKILRDVLGEYNPDLLSTF
DTVRNYAVEASAGHFSEVNNPNPSRDGLKEAVDVIDDMTLHDAQLLARAFATYFHLANLS
EENYRVSVLHERENNVSDDQAVDPINELTVAYHQLINEMGPAKAKELLDRLEFHPVFTAH
PTEARRKAVEGKIRRISELLEEYKSLGGLDKKESLRRLYNEIDALFRTSPIALKKPTPVE
EADTILDIFDNTLFNTIPAVYRRFDDWVLGDKAGLVEPACPAFFRPGSWIGSDRDGNPNV
TAKVSRQVARKFSDHVIAALEEVTRTVGRNLTMEAETTPPSADLKSLWSHQKEMSERLTD
KAALISNKELHRAVMLVMADRLHYTIERDADLMYHSCDDFIADLKVVQQSLATAGARRSA
YGPLQDLIWQAQTFGFHMVEMEFRQHSVVHARALADIREHGLHGERGDLQPMTHEVLDTF
RALGAIQKRNGLKAARRYIISFTKSAQNIKDVYELNRLAFSHPEDVPTIDVIPLFEQLED
LQNSVDVLEEMIKIPEVQARLKATGNKLEVMLGYSDSSKDAGPTSATLALHSAQERIAKW
AESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVGSVKCRFKLTEQGEVIFARYGNPVLA
IRHVESVAAATLLQSAPSVEKTNTEMTRKYADMAAQLDEAAHNRFLDLLGTDGFAPWFSI
VTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGTACEKFGD
LDTLRKAYEEWPLFSTFIDNIEMSIAKTDERIAKMYLALGDREDLNKKVLEEMELTRKWV
LAIVGDKWPLQHRHVLGQAIRIRSPYVDALSVTQVLALKSLRKKVDKEELSQSQQAGFIY
LILCTVSGVAAGLQNTG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaccagaagaacagatcactcctgctgacgccgccatcgtcaccaccggaacc
ggccgtaagggccccgaggagcatgatcttccccaaaacctcaagtacgacatggatctg
tgtttgaagatcctgcgtgacgtactgggcgaatacaatcccgatctgctttccacgttc
gacaccgtgcgcaattacgcagtggaggccagcgccgggcatttctccgaggtcaataat
ccgaacccctcacgggacggcttgaaagaggccgtggacgtcatcgacgatatgacgttg
cacgacgcccagttgctggcccgcgcgttcgccacgtatttccacctggcgaacctgtcc
gaggagaactaccgcgtctccgtgctgcatgagcgcgagaacaacgtgtccgacgaccag
gccgtcgatccgatcaacgaactcaccgtcgcctaccaccagctcatcaacgagatgggc
ccggccaaggccaaggagctgctcgaccggctcgagttccaccccgtgttcacggcgcac
cccaccgaggcccgccgcaaggccgtggaaggcaagattcgccgcatctccgaactgctc
gaggaatacaagagcctcggcggattggacaagaaggagagtctgcgccgtctctacaac
gaaatcgacgcgctgttccgcacctccccgatcgcgctgaagaaaccgaccccggtcgag
gaagcggacacgattctcgatatcttcgacaacaccctgttcaacacgattccggccgtc
taccgtcgcttcgacgactgggtgctgggcgacaaggccggcttggtggagcccgcgtgc
cccgcgttcttccgcccgggcagctggatcggctccgaccgcgacggcaacccgaacgtc
accgccaaggtgagccgtcaggtggcccgcaagttctccgatcatgtgatcgccgcactt
gaggaagtcacccgcacggtgggccgcaacctcaccatggaagccgagaccacgccgcca
agcgccgacctcaagagcctctggagccaccagaaggagatgagcgagcgtctgaccgac
aaggccgccctgatctccaacaaggaactgcaccgcgcggtcatgctggtgatggccgac
cgtctgcactacaccatcgaacgtgacgccgatctcatgtaccattcctgcgacgatttc
atcgccgacctcaaggtggtgcagcagtcgttggccaccgccggcgcgaggcgttccgcc
tacggcccgctgcaggaccttatctggcaggcgcagaccttcggcttccacatggtcgaa
atggagttccgtcagcactccgtggtgcatgcccgcgcccttgcggacatccgcgaacat
ggtctgcacggcgaacgcggcgatctgcagccgatgacccacgaggtgctcgacaccttc
cgcgcgctcggggccatccagaagcgcaacggcctcaaggccgcccgccgctacatcatc
tccttcaccaagagcgcccagaacatcaaggatgtctacgagctcaaccgtctggccttc
tcccatcccgaagacgtgcccaccatcgatgtgattccgctgttcgagcagctagaggat
ctgcagaactcggtggatgtgctcgaggaaatgatcaagatccccgaggtccaggctcgc
ctcaaggccaccggcaacaagctcgaggtcatgctcggctactccgattcctcgaaggac
gccggaccgacctccgccacgctggcgctgcactccgcccaggaacgcatcgccaagtgg
gccgaatcgcacgacatcgacctgacgctgttccatggccgcggcggcgccgtcggtcgc
ggcggcggcccggccaaccgtgcggtgctcgcccagccggtcggttccgtcaagtgccgc
ttcaagctcaccgaacagggcgaggtcattttcgcccgttacggcaacccggtgcttgcc
atccgccacgtggagtccgtagccgcggcgaccttgctgcagtccgccccgagcgtggag
aagaccaacaccgagatgacccggaagtacgccgacatggccgctcagctcgatgaggca
gcacataaccggttcctcgacttgctgggcaccgacggtttcgcgccgtggttctcgatc
gtcacgccgctgaccgagatcggcctgctgccgatcggctcccgcccggccaagcgtggc
ctgggcgccaagtccctcgacgatctgcgcaccatcccgtggatcttctcctgggctcag
gcacgcatcaacctggccgcttggtacggcctcggtaccgcatgcgagaagttcggcgat
ctggacacgctgcgcaaggcgtatgaggaatggccgctgttctccacgttcatcgacaac
atcgagatgtccatcgccaagacggacgagcgcatcgccaagatgtacctcgccctcggc
gaccgcgaggacctcaacaagaaggtgctcgaggagatggagctcacccgcaagtgggtg
ctcgccatcgtgggtgacaagtggccgctgcagcaccgccacgtgctcggccaggccatc
cgcattcgttcgccgtatgtggacgcgctgtccgtcacccaggtgctggcgctcaagtcg
ctacgcaagaaggtggacaaggaagagctctcgcaaagccagcaggcaggattcatctat
ctgatcctctgcaccgtttcaggtgttgctgccggcctgcagaacacgggctga

DBGET integrated database retrieval system