KEGG   Bifidobacterium breve JCM 7019: B7019_1816Help
Entry
B7019_1816        CDS       T03121                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
bbrc  Bifidobacterium breve JCM 7019
Pathway
bbrc00040  Pentose and glucuronate interconversions
bbrc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbrc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B7019_1816
Enzymes [BR:bbrc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     B7019_1816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AHJ19982
UniProt: W6FB42
LinkDB All DBs
Position
complement(1982693..1983733)
Genome map
AA seq 346 aa AA seqDB search
MKAVVLEKKGVINVREVPDTPAPAAGELTIAPHTVGVCGSDLHYYTHGRVGKYVVEQPMI
LGHEASGTVVAVGSGVEGFEVGDRVAMEPGIPDMNSRASKLGMYNVDPAVRFFATPPVDG
CLCETVNHPAAFTYKLPDNVSYGEGALLEPTAVGMWAATKAGIKPGDVCVVTGSGTVGML
TASCALAGGASKVIVSDVSSIKLDIIGKIPGIVPVDLTKEDLVERVREETGGWGADVIFE
CSGAPKAYETFFKLVAPGGTAVLVGIPVDPVSIDITELQATEVRIENVFRYANVYQKAID
LVASGKLNLKPFITDTYAMADAKAAFDRMDEGRPGDIKLQITVDRD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtcgttcttgagaagaagggcgtcatcaacgtgcgtgaggtgccggacacc
ccggctccggcggcgggggagctcaccatcgccccgcataccgtgggggtgtgcggatcc
gatctgcactattacacgcatgggcgtgtgggcaaatacgtggtcgaacagccgatgatc
ctggggcatgaggcttccggtaccgtcgtcgcggtcggctcaggcgtcgaaggcttcgaa
gtcggcgatcgcgtggccatggaacccggcattccggacatgaattcccgtgccagcaaa
ctcggcatgtacaacgtcgatccggccgtgcgtttcttcgccaccccgccggtggatggc
tgcctgtgcgagacggtcaaccatcccgcggcgttcacctacaagcttccggacaatgtg
agctatggcgagggagcgctgctcgaacccaccgccgtcggcatgtgggccgccaccaag
gccggcatcaaacccggcgacgtgtgcgtggtgaccggctccggcacggtgggcatgctc
accgcctcctgcgcgcttgccggtggcgcatccaaggtgatcgtctccgacgtttccagc
atcaaactcgacatcatcggcaagattccgggaatcgtgccggtggatctcaccaaggag
gatctcgttgaacgcgtgcgtgaggaaaccggaggctggggagccgacgtgatcttcgaa
tgctcgggtgcccccaaagcctacgagaccttcttcaagctcgtcgcgccgggcggcacc
gccgtcctcgtcggcatcccggtcgatcccgtgagcatcgacatcaccgagctgcaggcg
accgaggtgcgcatcgagaatgtgttccgttacgcgaacgtctaccagaaggccattgac
ctggtcgccagcggtaaactgaacctcaagccgttcatcaccgacacctatgcgatggcc
gatgccaaggccgccttcgaccgtatggatgagggacgtcccggcgatatcaagttgcag
attaccgtggatcgcgactga

DBGET integrated database retrieval system