KEGG   Bifidobacterium breve DSM 20213 = JCM 1192: BBBR_1173Help
Entry
BBBR_1173         CDS       T04525                                 

Definition
(GenBank) putative serine-threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bbrd  Bifidobacterium breve DSM 20213 = JCM 1192
Brite
KEGG Orthology (KO) [BR:bbrd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbrd01001]
    BBBR_1173
Enzymes [BR:bbrd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BBBR_1173
Protein kinases [BR:bbrd01001]
 Serine/threonine kinases: Other
  Bacterial family
   BBBR_1173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like RIO1 Haspin_kinase ABC1 Kdo
Motif
Other DBs
NCBI-ProteinID: BAR00212
UniProt: D4BS80
LinkDB All DBs
Position
1371315..1373462
Genome map
AA seq 715 aa AA seqDB search
MSENEPTQMIEGRYRIVRNIAEGGMATVYEAVDERLGRTVAIKVMHTQLAQGPHRDQFVE
RFRREANSAAAIANPHIVQVYDTGEFNGLDFLVMEYVHGVNLRHEMNVQGTFSVRETLRV
IAETLDGLASAHRAGVVHRDIKPENILINDRGHVQITDFGLAKAASQATLSSTGMLLGTA
AYLAPEMIENNQATPQGDLYSVGIMAWEMLAGKVPFDSDNPVTLVFKHVHEDVPSIATVC
PDIDPSVASFIAHLTARQVEARPANGSEAAQELRQLAAKLPMEAWQYRLHVESADAARTD
ATAPALVGGLVSPETAPRQSSGTPPEPPTAPTTAFNASSAREDLTQVMPNPGNETTILAK
TGDDFDQVLAAEDDAGSPDAKPTDGKRNKKPLIIALVIVLVLAVAAGTGAWWWFAGPGSY
WSVPKPDDVTCKEDTECSLSGADWATYESTLKVAGIPYKAEKQYSDDIAEGKIVSASVSE
NNAVVGSHVSKRHNQQLTVTVSQGVHMVTIPNDVLDTNSANGKDPLSALKKAGFDNIKHD
DSKDEYSLDKPEGAALSISPDPGTTIKHNDEVTVTLSKGPMPVSMPDVVGKTKDEMQAAF
DELKLTANITEQFDDKIAAGEVISASQDAGAQLKWGDSVDVVVSKGPETTVMPNVVGQQY
DAAAAQLKKLGFTVKKSAPLGDITHVVRIQSPNAGETVRLRDENGTPTVITLTVV
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaacgagcccacacagatgattgagggacgctaccgcatcgtgcgcaatatc
gccgaaggcggcatggccaccgtgtatgaggcggtcgatgagcgtttgggccgtactgtg
gcgatcaaggtcatgcacacgcagctggcacagggaccgcatcgagatcagttcgtggag
cggttccgccgtgaagccaattcagccgcggccatcgcaaacccgcatatcgttcaggtt
tacgacaccggtgagttcaatggccttgattttttggttatggaatatgtgcatggcgtc
aatctgcgccatgagatgaacgttcaaggcacattctccgtccgcgagacactgcgcgtt
atcgcggaaacgttggacggcttggcttcggcacatcgtgcaggcgtggtacatcgtgat
atcaaacccgaaaacatcctgatcaacgatcgcggccacgttcaaatcactgattttggt
ctggccaaggccgccagccaagcaacgctgagttccaccggcatgctgttgggcactgcg
gcctatctggctcctgaaatgatcgagaataatcaggccaccccacaaggcgatttgtat
tccgtgggcatcatggcttgggagatgcttgccggtaaagtgccttttgactccgataat
ccggtcacgcttgtgttcaagcatgttcatgaggatgtgccgtccatagccacggtctgt
ccggatatcgatccatccgtggcctcgttcattgcgcacctgactgcccgccaggtcgag
gctcgtcctgcgaacggctccgaggccgcccaggaacttcgtcaattggccgccaaactc
cctatggaggcatggcaatatcgtttgcatgtcgagtctgcggatgccgccagaaccgat
gctaccgcaccggctttggttggcggactggtttcgccggagaccgctcctaggcagagc
tctggcacgcccccggagcctcccaccgccccgaccaccgctttcaatgcgtcttccgca
cgagaagaccttacgcaagtcatgcccaaccccggtaatgagacaacgattctggcaaag
accggggatgatttcgaccaggtgctcgccgctgaagacgatgccggaagccccgatgcc
aagccaacggacggaaagcgcaacaagaagccgctcatcatcgccttggtaattgttctg
gtactggctgtagctgccggaaccggcgcatggtggtggttcgcaggtcccggcagctat
tggagtgtgcccaagcccgatgacgtgacgtgtaaggaggacaccgagtgctcgttgtcc
ggtgctgactgggccacgtatgagagcacgctgaaggtggcaggaatcccctataaggcc
gagaagcagtacagcgacgacatcgccgaaggcaagatcgtctccgcctcggtgagtgaa
aacaacgctgttgtaggcagtcacgtcagcaagcgtcacaatcagcaactgacggtgacg
gtctcgcagggtgtacacatggtcaccattccgaacgatgtcctcgatacgaattccgcg
aacggcaaggaccctctgtccgcgttgaagaaagcgggcttcgacaacatcaagcacgat
gattcgaaggacgagtattcgctggataagccggaaggcgcagcgctcagcataagcccc
gaccccggcaccacgatcaagcacaatgatgaagtgacagtgacgctcagcaagggtccc
atgcctgtcagcatgcctgacgtagtcggcaaaaccaaggatgagatgcaagcggcattc
gatgagctcaagctcaccgccaacatcaccgaacaattcgatgacaagattgccgcaggc
gaggtcatctccgcttcccaagacgctggcgcgcagctcaaatggggcgacagcgtagac
gtggtggtatccaagggacctgagaccacggtgatgccgaatgtggtgggtcagcagtat
gacgcggcagccgcacagctgaagaagctgggcttcactgtcaagaaatccgcaccgctg
ggcgacattacccatgtggtgcgtatccagagtcccaatgccggagaaacggtgcgtcta
cgcgacgaaaacggcactccaaccgttatcacgctgactgtggtgtga

DBGET integrated database retrieval system