KEGG   Bifidobacterium breve 12L: B12L_1575Help
Entry
B12L_1575         CDS       T03118                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
bbre  Bifidobacterium breve 12L
Pathway
bbre00040  Pentose and glucuronate interconversions
bbre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B12L_1575
Enzymes [BR:bbre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     B12L_1575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AHJ16302
LinkDB All DBs
Position
complement(1877292..1878332)
Genome map
AA seq 346 aa AA seqDB search
MKAVVLEKKGVINVREVPDTPAPAAGELTIAPHTVGVCGSDLHYYTHGRVGKYVVEQPMI
LGHEASGTVVAVGSGVEGFEVGDRVAMEPGIPDMNSRASKLGMYNVDPAVRFFATPPVDG
CLCETVNHPAAFTYKLPDNVSYGEGALLEPTAVGMWAATKAGIKPGDVCVVTGSGTVGML
TASCALAGGASKVIVSDVSSIKLDIIGKIPGIVPVDLTKEDLVERVREETGGWGADVIFE
CSGAPKAYETFFKLVAPGGTAVLVGIPVDPVSIDITELQATEVRIENVFRYANVYQKAID
LVASGKLNLKPFITDTYAMADAKAAFDRMDEGRPGDIKLQITVDRD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtcgttcttgagaagaagggcgtcatcaacgtgcgtgaggtgccggacacc
ccggctccggcggcgggggagctcaccatcgccccgcataccgtgggggtgtgcggatcc
gatctgcactattacacgcatgggcgtgtgggcaaatacgtggtcgaacagccgatgatc
ctggggcatgaggcttccggtaccgtcgtcgcggtcggctcaggcgtcgaaggcttcgaa
gtcggcgatcgcgtggccatggaacccggcattccggacatgaattcccgtgccagcaaa
ctcggcatgtacaacgtcgatccggccgtgcgtttcttcgccaccccgccggtggatggc
tgcctgtgcgagacggtcaaccatcccgcggcgttcacctacaagcttccggacaatgtg
agctatggcgagggagcgctgctcgaacccaccgccgtcggcatgtgggccgccaccaag
gccggcatcaaacccggcgacgtgtgcgtggtgaccggctccggcacggtgggcatgctc
accgcctcctgcgcgcttgccggtggcgcatccaaggtgatcgtctccgacgtttccagc
atcaaactcgacatcatcggcaagattccgggaatcgtgccggtggatctcaccaaggag
gatctcgttgaacgcgtgcgtgaggaaaccggaggctggggagccgacgtgatcttcgaa
tgctcgggtgcccccaaagcctacgagaccttcttcaagctcgtcgcgccgggcggcacc
gccgtcctcgtcggcatcccggtcgatcccgtgagcatcgacatcaccgagctgcaggcg
accgaggtgcgcatcgagaatgtgttccgttacgcgaacgtctaccagaaggccattgac
ctggtcgccagcggtaaactgaacctcaagccgttcatcaccgacacctatgcgatggcc
gatgccaaggccgccttcgaccgtatggatgagggacgtcccggcgatatcaagttgcag
attaccgtggatcgcgactga

DBGET integrated database retrieval system