KEGG   Bifidobacterium breve JCM 7017: B7017_0297Help
Entry
B7017_0297        CDS       T03120                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bbrj  Bifidobacterium breve JCM 7017
Pathway
bbrj00473  D-Alanine metabolism
bbrj00550  Peptidoglycan biosynthesis
bbrj01100  Metabolic pathways
bbrj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bbrj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B7017_0297
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B7017_0297
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    B7017_0297
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bbrj01011]
    B7017_0297
Enzymes [BR:bbrj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B7017_0297
Peptidoglycan biosynthesis and degradation proteins [BR:bbrj01011]
 Precursor biosynthesis
  Amino acid ligase
   B7017_0297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AHJ16846
LinkDB All DBs
Position
374731..375918
Genome map
AA seq 395 aa AA seqDB search
MAKKRIVVLYGGRADEHSISCISTAGVLAAMDTERFEPIPVGITKDGKWIIDGEDPRGWN
LDGDELPTVKITPKSRPVILDPSRGKDGFFAGEPDHLSNADSGFGTSFVSLSDPEIHHVL
TSLGHVDAVLPVLHGPYGEDGTVQGLLEMMGVPYVGCGVFASAACMDKHYTKVVLNAAGI
PTAPGIMVDARAFTAADVVAQIEVAGLAYPLFVKPSRAGSSFGVTKVDKAEDLETQQDRV
AAAIATAGEHDWKVLIEQGIDGREIECAVLCPKAGDEPEASWPGEIVLDHQNDDQFYDFD
SKYMDASASHVEVPANLPVSVLEDVRDVARRAFKAVDGAGLSRVDTFVTPDGTVMVNEIN
TMPGFTPISMYPKAWDATGVGYTELITRLIEGVLK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaaacgtattgtggtgctctatggtgggcgtgcggatgaacattcgatttcc
tgcatctccacggccggcgtgctggcggctatggataccgaacgtttcgagccgattccg
gtgggcatcaccaaggacggcaagtggattatcgacggtgaggatccgcgcggctggaat
ctggacggcgacgagctgccgaccgtgaagatcacgccgaaatcccgtccggtgattctc
gacccctcgcgaggcaaggacggtttctttgccggtgagccggatcatctcagcaatgcc
gactccggttttggcaccagctttgtgagcttgtccgatcctgagatacatcacgtgctg
acctcgctggggcatgtcgatgcggtgctgcctgtgctgcatggcccttacggcgaggac
ggcacggtgcagggtcttcttgagatgatgggtgtgccgtatgtgggctgtggcgtgttc
gcctctgccgcctgcatggataagcactacaccaaagtggtgctcaatgctgccggtatt
ccgacggctcccggcattatggtggatgcgcgcgcgttcactgcagccgatgtggtcgcc
cagatcgaggtcgccggattggcttatccgctgttcgtcaagccttcccgtgctggatcc
agctttggcgtcaccaaggtggataaagccgaggatctggaaacccagcaggaccgtgtg
gccgctgccatcgccacggccggtgagcatgactggaaggtgctcatcgagcagggcatc
gacggccgcgagatcgaatgcgccgtgctgtgcccgaaggcgggcgatgagcccgaggcc
agctggcccggcgaaatcgtgcttgaccaccagaatgacgaccagttctatgatttcgat
tccaagtacatggatgcttccgccagccatgtggaagtgccggccaacctgcccgtcagc
gtgcttgaggatgtacgcgacgtggctcgccgtgcgttcaaggccgtagatggagcgggt
ctgagccgcgtggataccttcgtgactccggacggcaccgtgatggtcaacgagatcaac
accatgcctggcttcacgccgatttccatgtatcccaaggcgtgggacgccacgggtgtg
ggatacaccgaactcatcacccgtctgatcgaaggcgtgttgaagtaa

DBGET integrated database retrieval system