KEGG   Bifidobacterium breve JCM 7017: B7017_1599Help
Entry
B7017_1599        CDS       T03120                                 

Definition
(GenBank) Dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
bbrj  Bifidobacterium breve JCM 7017
Pathway
bbrj00290  Valine, leucine and isoleucine biosynthesis
bbrj00770  Pantothenate and CoA biosynthesis
bbrj01100  Metabolic pathways
bbrj01110  Biosynthesis of secondary metabolites
bbrj01130  Biosynthesis of antibiotics
bbrj01210  2-Oxocarboxylic acid metabolism
bbrj01230  Biosynthesis of amino acids
Module
bbrj_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bbrj_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bbrj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    B7017_1599
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    B7017_1599
Enzymes [BR:bbrj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     B7017_1599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AHJ17851
LinkDB All DBs
Position
complement(1627936..1629798)
Genome map
AA seq 620 aa AA seqDB search
MTEMRSAKIMSGRVFAGARALYRAAGVSGDDMGKKPIIAIANSFDEFLPGHVHLNKVGRI
VSEAIREAGGIPREFNTMAVDDGIAMGHTGMLYSLPSRDIIADTVEYQCNAHCADALICI
PNCDKVVPGMLMAALRLNIPTVFVSGGPMEAGTTVLADGTVKSTDLIDVMYATADDSVSD
EELLNYEKTVCPTCGSCAGMFTANSMNCLTEAIGLALPGNGTILASHSYRKDLFKRAAQQ
VVKIAHQYYDDSDDSVLPRSIATKEAFENAMTMDVAMGGSTNTVLHILAMAQSADVDFTL
DDIERISHTVPCICKASPSGKWEISDVHRAGGITGILGELERAGKLHTNVHSIDYPTLEA
KLADWDIMRPTCTEEAKQMYKAAPGHIISPEPWTHTTLFDSLDTDRVNGAIHDINHPEIH
EGGLAVLRGNLAPDGCVVKTAGVPPEIWKFRGPALVVDSQEQAIEVILNDTLKPGMALVI
RYEGPKGGPGMQEMLYPTSFVKGKGIGKQVAMLTDGRYSGGSSGLAIGHMAPEAANKGPV
ALIKNGDIIDIDIEARSVNVELTDEQLDERRRELEAGDGYVAHRDRHVSQALKAYAAFAR
SADKGATRDPELINKLSGLA
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatgcgatctgcaaaaattatgtcagggcgcgtctttgcaggcgctcgagcc
ctttaccgtgctgcaggcgtcagcggagacgacatgggcaagaagcccatcatcgccatc
gccaactccttcgatgagttcctgcctggccacgttcatctgaacaaggtcggacgcatc
gtttccgaggccatccgagaagccggcggtatcccgcgcgagttcaacacgatggctgtg
gacgacggcatcgccatgggccacaccggcatgctgtactccctgccttcccgcgacatc
atcgctgacaccgtcgaataccagtgcaacgcgcactgtgccgacgccctgatctgcatc
ccgaactgcgacaaggtcgtgccgggcatgctgatggccgccctgcgcctcaacatcccg
accgtgttcgtctccggcggcccgatggaggccggcaccacggtgctcgccgacggcacc
gtcaagagcaccgacctcatcgacgtgatgtacgccaccgccgacgactccgtctccgat
gaggaactgctcaactacgagaagaccgtctgcccgacctgtggctcctgcgctggcatg
ttcaccgccaactcgatgaactgcctgaccgaggccatcggcttggctctgcccggcaac
ggcaccatcctcgcctctcactcctaccgcaaggatctgttcaagcgcgccgcccagcag
gtcgtcaagatcgcccaccagtactacgacgattccgacgattccgtgctgccgcgctcc
atcgccaccaaggaagcttttgagaacgccatgaccatggatgtggccatgggtggttcc
accaacaccgtgctgcacattctcgccatggcccagtccgccgatgtggacttcaccttg
gacgacatcgaacgcatctcgcacaccgtgccgtgcatctgcaaggccagcccgtccggc
aagtgggagatttccgatgtgcaccgtgccggcggcatcaccggcatcctcggcgaactc
gagcgcgcaggcaagctgcacaccaacgtgcactccatcgactacccgacgctggaagcc
aagctggccgattgggacatcatgcgccccacctgcacagaggaagccaagcagatgtac
aaggccgctcctggccacatcatctccccggagccgtggacgcacaccactctgtttgat
tcgctcgacaccgaccgtgtcaacggcgccatccacgacatcaaccacccggagatccac
gaaggcggtctcgccgtgctgcgcggcaatctggcccctgacggctgcgtggtcaagacc
gccggtgttccaccggagatctggaagttccgtggaccggctctggtggtcgactcccag
gagcaggccatcgaggtcatcctgaacgacaccctgaagcccggcatggctctggtcatt
cgttacgagggtccgaagggtggcccgggtatgcaggaaatgctgtacccgacctccttc
gtcaagggcaagggcatcggcaagcaggtcgcaatgctcaccgacggccgctactccggt
ggttcctccggtctggccattggccacatggctcctgaggccgcgaacaaggggccggtg
gcgctcatcaagaacggcgacatcatcgacatcgacatcgaagcccgttccgtgaacgtt
gagctgaccgacgagcagctggacgagcgtcgtcgtgaacttgaggccggcgacggctac
gtggctcaccgcgaccgtcacgtctcccaggcgttgaaggcatacgccgccttcgcccgc
tcggccgacaagggggcaacccgtgacccggagcttatcaacaaactctccggtctcgcc
tga

DBGET integrated database retrieval system