KEGG   Bifidobacterium breve JCM 7017: B7017_1796Help
Entry
B7017_1796        CDS       T03120                                 

Definition
(GenBank) Ribose 5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
bbrj  Bifidobacterium breve JCM 7017
Pathway
bbrj00030  Pentose phosphate pathway
bbrj01100  Metabolic pathways
bbrj01110  Biosynthesis of secondary metabolites
bbrj01120  Microbial metabolism in diverse environments
bbrj01130  Biosynthesis of antibiotics
bbrj01200  Carbon metabolism
bbrj01230  Biosynthesis of amino acids
Module
bbrj_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bbrj_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bbrj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B7017_1796
Enzymes [BR:bbrj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     B7017_1796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-ProteinID: AHJ18028
LinkDB All DBs
Position
1872920..1873618
Genome map
AA seq 232 aa AA seqDB search
MDKAQQDALKKAAGIEAAKLIEDGMIAGLGTGSTVKFLVDELGRRHQEEGLEFTGVTTSR
RTQAQAESYGIKIVDIDDVDHIDVTIDGADEVDKNFNGIKGGGAALLWEKIVATNSNQIV
WIVDESKVVDTIGKFPLPVEVIPFGAGHVIKKFEERGYKPVLRLDAEGKEVRTDENNFVV
DLHLERIDHPQELAEDLINTVGVVEHGLFLNMVDKVIVGDPNGPRVMTNANK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggataaggcacagcaggatgcgctgaagaaggcggccggcatcgaagccgccaagctc
atcgaagatggcatgatcgccggtctcggcaccggttcgaccgttaagttcctggtagat
gagctcggccgccgtcatcaggaagaaggcctcgagttcaccggcgtgactacttcccgc
cgcacccaggctcaagccgaaagctacggcatcaagatcgtggacatcgatgacgtggac
cacatcgacgtgaccattgacggcgctgacgaggtcgataagaacttcaacggcatcaag
ggcggcggcgctgccctgctgtgggagaagatcgtggccaccaactccaaccagatcgtg
tggatcgtggacgagtccaaggtggtggacaccatcggcaagttcccgctgccggtcgag
gtcatcccgttcggcgccggccatgtgatcaagaagttcgaggagcgcggctacaagccg
gtgctgcgtcttgacgccgaaggcaaggaagtgcgcaccgacgagaacaacttcgtggtg
gatctgcacctggagcgcatcgatcacccgcaggagctggccgaggacctcatcaacacg
gtcggcgtggtggagcacggcctgttcctcaacatggtagacaaggtcatcgtcggcgac
ccgaacggcccgcgcgtgatgaccaacgccaataagtga

DBGET integrated database retrieval system