KEGG   Bordetella bronchialis: BAU06_04515Help
Entry
BAU06_04515       CDS       T04591                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbro  Bordetella bronchialis
Pathway
bbro00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bbro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BAU06_04515
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbro02000]
    BAU06_04515
Enzymes [BR:bbro01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BAU06_04515
Transporters [BR:bbro02000]
 Other Transporters
  Pores ion channels [TC:1]
   BAU06_04515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_C_2 GST_N GST_C GST_N_2
Motif
Other DBs
NCBI-ProteinID: ANN65654
LinkDB All DBs
Position
complement(1024538..1025197)
Genome map
AA seq 219 aa AA seqDB search
MALQLYFHPFSSYCQKVLIPLYDNGIPFESRIVEGPDSPAGRELAERWPMKRFPMLVDGD
RTVMEATCIVEYLDLVHPGPARMIPADPAEALETRFMDRFFDNYIATPVQQIVFNEMRPE
AARDPYGVRNWRGMLDTAYAWLDRKMADRTWAAGDRFSLADCGAAPHLFYADWTHPIPAA
CGNVRAYRARLLEHPSFARAVDDARPYRAWFPLGAPDRD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcaactgtatttccacccgttttcctcctactgccagaaggtgctgatcccg
ctctacgacaacggcatccctttcgagtcccgcatcgtggaaggcccggacagcccggca
ggcagggagctggccgagcgctggcccatgaaacgcttccccatgctggtcgacggcgat
cgcaccgtgatggaggccacctgcatcgtcgaatatctggacctggtccacccgggcccc
gcgcgcatgatcccggcggaccccgcggaagccctggagacccgcttcatggaccggttc
ttcgacaactacatcgccacgccggtgcagcagatcgtcttcaacgagatgcgtccggaa
gcggcgcgcgacccctacggcgtacgcaattggcgcggcatgctggacaccgcctacgcc
tggctggaccggaaaatggcggatcggacctgggccgcgggagaccgcttcagcctggcg
gactgcggtgcggcgccgcacctgttctacgccgactggacgcatcccatccccgccgcc
tgcggcaacgtccgcgcgtatcgcgcccgcctgctggagcatccctccttcgcccgcgcg
gtcgacgacgccaggccctaccgcgcctggtttccgctgggcgcgccggaccgggactga

DBGET integrated database retrieval system