KEGG   Bordetella bronchialis: BAU06_10635Help
Entry
BAU06_10635       CDS       T04591                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bbro  Bordetella bronchialis
Pathway
bbro00564  Glycerophospholipid metabolism
bbro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAU06_10635
Enzymes [BR:bbro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BAU06_10635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 HI0933_like GIDA Pyr_redox_2 NAD_binding_8 FAD_binding_3 Thi4 Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ANN66676
UniProt: A0A193FHK3
LinkDB All DBs
Position
complement(2356233..2357831)
Genome map
AA seq 532 aa AA seqDB search
MTPIRPVTPPTRERLLAQLDSAQPWDVIVIGGGATGLGTAVDAAARGYRTLLVEAADFAK
GTSSRATKLVHGGVRYLAQGNISLVREALHERGLLGRNAPHVVWPLGFVVPAYGLLDQPF
YGIGLKMYDVLAGRLNLRSSRLLSRAQALADAPTLAPEVGGHRLRGGVLYYDGQFDDARL
ATALMRTLFDLGGMAVNYMAVTGLNQSNGRIDGVTVRDMLGGTTFVLHGKCVVNATGVWV
DEIRRMEDRSAMGLVAPSQGVHLTLPRDFLPGANAILIPKTDDGRVLFVVPWNGHTIVGT
TDAPRADLPVEPDASRADVDFILDTAGRYLSRKPTRADVTSVWSGLRPLVKSSGVGATKT
LSREHTILLSDAGLITVTGGKWTTYRRMAQDVMDMAVREQLLPYAPCRTQDLPLHGAAGA
AAGLAPAGTPDAYYGSDLPQLRALPGADRILVSASGLSEAHVRFAARFELARSVEDVLAR
RNRALFLDSAAALRAAPDVARILAEELGHDAAWQRRSVADFERTAQVYRLAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacccccatccgccccgtgacgccccccacccgcgaacgcctgctggcgcaactcgac
tccgcccagccctgggacgtcatcgtcatcggcggcggcgccaccggcctgggcaccgcg
gtggacgcggcggcacgcggctaccgcaccctgctggtcgaggccgcggacttcgccaag
ggcacgtccagccgcgccaccaagctggtccacggcggcgtgcgctacctggcccagggc
aacatcagcctggtgcgggaggccctgcacgaacgcgggctgctgggccgcaacgcgccc
cacgtggtgtggccattgggcttcgtcgtgccggcctacggcttgttggaccagcccttc
tatgggatcggcctgaagatgtacgacgtactggccgggcggctcaacctgcggtccagc
cgcctgttgtcgcgcgcgcaggcgctggcggacgcgccgacgctggcgccggaagtcggc
ggccaccggctgcgtggcggcgtcctgtactacgacggccagttcgacgatgcccggctg
gccaccgcgctgatgcgcaccttgttcgacctgggcggcatggcggtcaactacatggcg
gtcaccgggctgaaccagagcaacggccgcatcgacggcgtgacggtgcgcgacatgctg
ggcggcaccaccttcgtcctgcatggcaagtgcgtggtgaacgccaccggggtctgggtg
gacgaaatccgccgcatggaggaccgctccgccatggggctggtggcgcccagccagggc
gtgcacctgacgctgccgcgcgatttcctgccgggcgccaacgccatcctgatacccaag
accgacgatggccgcgtgctgttcgtcgtgccatggaacggccataccatcgtcggcacc
acggatgcgccgcgcgccgacctgcccgtggagcccgatgccagccgcgccgatgtggac
ttcatcctggacacggcggggcgctacctgagccgcaagcccacgcgcgccgacgtcacc
agcgtatggagcggcctgcgtcccctggtcaagtccagcggcgtgggcgcgaccaagaca
ctgtcgcgcgagcacaccatcctgctgtccgacgccggcctgatcaccgtgaccggcggc
aagtggaccacctaccgccgcatggcgcaggacgtcatggacatggccgtgcgcgaacag
ctgttgccctatgcgccctgccgcacccaggacctgccgctgcacggcgccgcgggcgcg
gcggccggcctggcgccggcgggcacgccggacgcctactacggcagcgatctgccgcag
ctgcgcgccctgccgggcgccgaccgcatcctggtgtccgccagcggcctgagcgaagcg
catgtgcgtttcgccgcgcgcttcgaactggcgcgcagcgtggaggacgtactggcgcgc
cgcaatcgggccttgttcctggacagcgcggccgcgctgcgcgcggcgccagacgtcgcc
cgcatcctggcggaggaactgggccacgatgccgcctggcagcgccgcagcgtggcggac
ttcgagcgcaccgcccaggtgtaccggttggccgcctag

DBGET integrated database retrieval system