KEGG   Bordetella bronchialis: BAU06_11665Help
Entry
BAU06_11665       CDS       T04591                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bbro  Bordetella bronchialis
Pathway
bbro00061  Fatty acid biosynthesis
bbro00780  Biotin metabolism
bbro01100  Metabolic pathways
bbro01212  Fatty acid metabolism
Module
bbro_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bbro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BAU06_11665
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BAU06_11665
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bbro01004]
    BAU06_11665
Enzymes [BR:bbro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BAU06_11665
Lipid biosynthesis proteins [BR:bbro01004]
 Fatty acid synthase
  Component type
   BAU06_11665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: ANN66856
UniProt: A0A193FVZ4
LinkDB All DBs
Position
2640199..2640660
Genome map
AA seq 153 aa AA seqDB search
MELDIKGILDRLPHRYPMLLIDRVIDIQPGKSIVALKNVSINEPFFTGHFPHHPVMPGVL
ILEAMAQAAALFSFSDESALKNDDAGGASTVYYFVGIDGARFRRPVLPGDQLRIEVDAER
LSRSICKYAGRALVDGQLVAEAKLMCAIRSLEA
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggaactcgacattaaggggatcctggatcgcttgccgcatcgttacccgatgctgttg
atcgaccgcgtgatcgacatccagcccggcaaatccatcgttgccctgaagaacgtttca
atcaacgagcctttcttcaccggacacttcccgcaccatccggtcatgccgggcgtgctt
atcctggaagccatggcccaggcggccgcgctgttctccttctcggatgaatccgcgctg
aagaatgacgatgccggcggcgcgtccacggtgtattacttcgttggcatcgacggcgcg
cgcttccgccgtcccgtgctgccgggcgaccagctgcgtatcgaagtggacgccgagcgg
ctgagccgcagcatctgcaaatatgccggccgtgccctggtggacggccagctggtcgcc
gaagccaagctcatgtgtgccatccgcagcctggaagcataa

DBGET integrated database retrieval system