KEGG   Bordetella bronchialis: BAU06_15285Help
Entry
BAU06_15285       CDS       T04591                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bbro  Bordetella bronchialis
Pathway
bbro03030  DNA replication
bbro03410  Base excision repair
bbro03420  Nucleotide excision repair
bbro03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bbro00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BAU06_15285
   03410 Base excision repair
    BAU06_15285
   03420 Nucleotide excision repair
    BAU06_15285
   03430 Mismatch repair
    BAU06_15285
Enzymes [BR:bbro01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BAU06_15285
    6.5.1.6  DNA ligase (ATP or NAD+)
     BAU06_15285
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BAU06_15285
DNA replication proteins [BR:bbro03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BAU06_15285
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BAU06_15285
DNA repair and recombination proteins [BR:bbro03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BAU06_15285
   NER (nucleotide excision repair)
    Other NER factors
     BAU06_15285
   MMR (mismatch exicision repair)
    Other MMR factors
     BAU06_15285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ANN67484
LinkDB All DBs
Position
complement(3462781..3464445)
Genome map
AA seq 554 aa AA seqDB search
MKDFADLYTRLDATTSSNAKLAAMRDYFRQAPPADGAWAAYFLAGGKPRQLVPTKILRQF
IMDAAGIPEWLFEESYQAVGDLAETLSLLLPDPGTPDTASLAEWVEERLLPLRGLPPAEI
LYRLRDLFGRLDQHGRFVCAKLMTGAMRVGVSKLLLTRALAEVAGVETRHMSQRLIGYTD
IGARPQADVFARLLEPVSHEGQARVDGQPYPFFLAHPLNADVAAFDDLLGPPAGWQVEWK
WDGIRAQLVRRAEQTWVWSRGEELVTERFPELMRLGTRLPEGTVLDGEIVVWREDRVQPF
AHLQQRLGRKTVGARLLAEAPVVLLAYDLLEFDGEDLRGRTQAERRAMLERLADGIRDPA
LVLSPLLRGADWQDLARQREASRALGVEGMMLKAADARYGVGRTKESGVWWKWKVDPFSV
DAVLIYAQRGHGRRASLYTDYTFAVWDAPPESAERRLVPFAKAYSGLTDEEIRQVDAIVR
KTTVEKFGPVRSLEPTQVFELGFEGIARSSRHKSGIAVRFPRMLRWRQDKTPQDADTLET
LAALLPDGSGGPST
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacttcgccgacctgtacacccgcctggacgccaccacgtccagcaacgccaag
ctggccgcgatgcgggattacttccgccaggcgcctcccgccgacggcgcctgggccgcc
tacttcctggcgggcggcaagccgcgccagctggtgcccaccaagatcctgcggcagttc
atcatggacgccgccgggattccggaatggctgttcgaggaaagctaccaggccgtgggc
gacctggcggaaacgctgtccctgctgctgcccgaccccggcacgcccgatacggccagc
ctggccgagtgggtggaggaacggctgctgccgctgcgcggcctgccgcctgcggaaatc
ctgtatcgcctgcgggacctattcggccgcctggatcaacatggccgcttcgtctgcgcc
aagctgatgacgggcgcgatgcgggtgggcgtctccaagctgctcctgacgcgggcgctg
gccgaagtggccggcgtggagacccgccacatgtcgcagcgcctgatcggctataccgac
atcggcgcccgcccgcaggccgacgtgttcgcgcgcctgctggagccggtctcgcacgaa
ggccaggcgcgggtcgacggccagccctatcctttcttcctggcgcaccccctgaatgcc
gacgtggcggccttcgacgatctgctcggcccgccggcaggctggcaggtcgaatggaag
tgggacggcatccgcgcccagctggtgcgccgggccgagcagacctgggtctggtcgcgt
ggcgaagaactggtcaccgaacggtttccggagctgatgcgcctgggcacgcggctgccc
gaaggcacggtgctggacggggagatcgtcgtctggcgcgaagaccgcgtgcagcccttc
gcccatctgcagcagcgcctgggccgcaagacggtcggcgccaggctgctggccgaggcc
cccgtcgtgctgctggcctacgacctgctcgagttcgatggcgaagacctgcgcggccgc
acgcaagccgagcgccgcgccatgctggagcgcctggccgatgggatccgggatccggcg
ctggtgctgtcgccgctgctgcggggggcggattggcaggacctggcgcgccagcgtgaa
gcctcgcgcgccctgggcgtggagggcatgatgctgaaggccgccgacgcccgctacggc
gtggggcgcaccaaggaaagcggcgtctggtggaagtggaaggtggatccgttctccgtg
gacgccgtattgatttatgcgcagcgcggccatgggcggcgcgccagcctgtataccgat
tacaccttcgcggtctgggacgcgccgccggagtcggcggaacgccgcctggtgcctttc
gccaaggcctattccggcctgaccgacgaggagatccgtcaggtcgacgccatcgtgcgg
aaaaccaccgtcgaaaaattcgggcccgtgcgcagcctggaacccacgcaggtattcgaa
ctggggttcgaaggcatcgcccgcagcagccgccacaaaagcggcatcgccgtgcgcttt
ccgcgcatgctgcgttggcggcaggacaagacgccgcaggatgccgacaccctggaaacc
ctggcggcgctgttgccggatggttccgggggcccgtccacttga

DBGET integrated database retrieval system