KEGG   Bordetella bronchialis: BAU06_23905Help
Entry
BAU06_23905       CDS       T04591                                 

Definition
(GenBank) anthranilate synthase component 2
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
bbro  Bordetella bronchialis
Pathway
bbro00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbro00405  Phenazine biosynthesis
bbro01100  Metabolic pathways
bbro01110  Biosynthesis of secondary metabolites
bbro01130  Biosynthesis of antibiotics
bbro01230  Biosynthesis of amino acids
bbro02024  Quorum sensing
Module
bbro_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAU06_23905
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    BAU06_23905
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BAU06_23905
Enzymes [BR:bbro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     BAU06_23905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 Peripla_BP_2
Motif
Other DBs
NCBI-ProteinID: ANN68940
LinkDB All DBs
Position
5446432..5446989
Genome map
AA seq 185 aa AA seqDB search
MIDNYDSFTYNLVQYFGELGEDVRVARNDQITLEEIAAMKPDRICVSPGPCSPTEAGISV
ALIQEFAGKVPILGVCLGHQAIGTAFGGDIVRAPRIMHGKTVRISHTGTDIFAGLPTPHT
VIRYNSLTIDPATLPDCLEATATAEDGDIMGVRHKTLPIYGVQFHPESVLSEHGHALMRN
FLNIG
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacaactacgattccttcacctacaacctggtgcagtatttcggcgaactcggc
gaagacgtgcgcgtggcgcgcaacgaccagatcacgctggaagaaatcgccgccatgaag
ccggaccgcatttgcgtgtcgccgggcccctgctcgcccaccgaagcagggatttccgtc
gcgctgatacaggaattcgctggcaaggttcccatcctgggcgtttgcctgggccaccag
gccatcggcaccgccttcggcggcgatatcgtgcgcgcgccgcgcatcatgcatggcaag
accgtgcgcatttcgcatacgggcaccgacatcttcgccggcctgcccacgccccacacc
gtcatccgctacaactcgctgaccatcgacccggccaccctgcccgactgcctggaagcg
accgccaccgcggaagacggggacatcatgggcgtgcgtcataaaacgctgcccatatac
ggggtacagttccaccccgaatcggtgttgagcgaacacggccatgccttgatgcgcaac
ttcctgaacatcggataa

DBGET integrated database retrieval system