KEGG   Bordetella bronchialis: BAU06_24370Help
Entry
BAU06_24370       CDS       T04591                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
bbro  Bordetella bronchialis
Pathway
bbro00630  Glyoxylate and dicarboxylate metabolism
bbro01100  Metabolic pathways
bbro01120  Microbial metabolism in diverse environments
bbro01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbro00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BAU06_24370
Enzymes [BR:bbro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BAU06_24370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ANN69021
LinkDB All DBs
Position
complement(5551704..5552969)
Genome map
AA seq 421 aa AA seqDB search
MTDTQRRDFRATYFIETPFPLEQAAEVLAGEQSSGTFVRVAGETDDLRRRSRAIVRSIRQ
TGVSAVPSLPNAFLERRGVPGPYRQAVITVSFPVDNVGANLPTLAATVGGNIYDLGEMTG
VKLLSLDLPPEYVRLFDAPRHGVAGTRALAGRRDGPILGTIIKPNVGMTPEQTAGVVAGL
CDAGVDFIKDDECMANPPHSPLARRVEAVMRVINDHAQRTGRKVMYAFNISDDLDAMRGH
AARVEAAGGTCVMASLNWCGFSAIQALRRSTPLAIHGHRNGMAAMSRHPGLGIAFPAYQA
LWRLAGVDQLHVNGLGGKFYESDESVIESARACLAPLAGDDAVMPVFSSGQWAGTVPSTF
AGLGTDDLIFLSGGGILGHPDGAAAGVQSIRDAWDAARAGVPLPDFARDRPALAHALAFY
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgacggacacccagcggcgcgacttccgcgccacgtatttcatcgagactcccttcccg
ctggagcaggccgccgaggtcctggccggcgaacagtccagcggcaccttcgtgcgggtg
gccggcgaaaccgacgacctgcgccggcgatcgcgcgccatcgtgcgatcgatccgccag
accggcgtgtcggctgtgcccagcctgcccaatgccttcctggaacggcgcggcgtgccg
ggcccctaccggcaggccgtgatcacggtgtcctttccggtcgacaatgtcggcgccaac
ctgcccaccctggcggccacggtgggcggcaatatctacgacctgggcgaaatgaccggc
gtcaagctcctgtcgctggacctgccgcccgagtacgtcaggctgttcgacgcgccgcgc
cacggcgtggccggcacgcgcgccctggccggccgccgcgatggccccatcctgggcacc
atcatcaagcccaacgtcggcatgacgccggagcagaccgccggcgtggtggccggcctg
tgcgacgccggcgtggacttcatcaaggacgacgaatgcatggcgaatccgccgcattcg
ccgctggcccggcgggtcgaggccgtcatgcgcgtcatcaacgaccatgcgcagcgtacc
ggccgcaaagtcatgtacgccttcaatatttccgacgacctggacgccatgcgcggccac
gccgcgcgggtggaagcggccggcggcacctgtgtcatggccagcctgaactggtgcggc
ttcagcgccatccaggccctgcggcgcagcacgcccctggccatacacggccaccgcaac
ggcatggcggccatgtcgcgccatcccgggctgggcatcgcctttccggcctaccaggcg
ctgtggcgcctggcgggcgtggaccagctgcacgtcaacgggctgggcggcaagttctac
gaaagcgacgaaagcgtcatcgaatccgcgcgggcctgcctggcgccgctggcgggcgac
gatgcggtgatgccggtgttttcctcggggcaatgggccgggaccgtgccgtccaccttc
gcgggcctgggcacggacgacctgattttcctgtccgggggcggtatcctcgggcacccc
gacggcgccgccgccggggtgcagagcatacgcgacgcctgggacgccgcgcgggccggc
gtgccgctgccggacttcgcgcgcgaccggcccgcgctggcgcatgccctggctttctat
ggttga

DBGET integrated database retrieval system