KEGG   Bifidobacterium breve UCC2003: Bbr_1174Help
Entry
Bbr_1174          CDS       T02534                                 

Gene name
pknA2
Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bbru  Bifidobacterium breve UCC2003
Brite
KEGG Orthology (KO) [BR:bbru00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbru01001]
    Bbr_1174 (pknA2)
Enzymes [BR:bbru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Bbr_1174 (pknA2)
Protein kinases [BR:bbru01001]
 Serine/threonine kinases: Other
  Bacterial family
   Bbr_1174 (pknA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like RIO1 Haspin_kinase ABC1 Kdo
Motif
Other DBs
NCBI-ProteinID: ABE95852
UniProt: F9Y186
LinkDB All DBs
Position
1465679..1467826
Genome map
AA seq 715 aa AA seqDB search
MSENEPTQMIEGRYRIVRNIAEGGMATVYEAVDERLGRTVAIKVMHTQLAQGPHRDQFVE
RFRREANSAAAIANPHIVQVYDTGEFNGLDFLVMEYVHGVNLRHEMNVQGTFSVRETLRV
IAETLDGLASAHRAGVVHRDIKPENILINDRGHVQITDFGLAKAASQATLSSTGMLLGTA
AYLAPEMIENNQATPQGDLYSVGIMAWEMLAGKVPFDSDNPVTLVFKHVHEDVPSIATVC
PDIDPSVASFIVHLTARQVEARPANGSEAAQELRQLAAKLPMEAWQYRLHVESADAARTD
ATAPALVGGLVSPETAPRQSSDTPPEPPTAPTTAFNASSAREDLTQVMPNPGNETTILAK
TGDDFDQVLAAEDDAGSPDAKPTDGKRNKKPLIIALVIVLVLAVAAGTGAWWWFAGPGSY
WSVPKPDDVTCKEDTECSLSGADWATYESTLKVAGIPYKAEKQYSDNIAEGKIVSASVSE
NNAVVGSHVSKRHNQQLTVTVSQGVHMVTIPNDVLDTNSANGKDPLSALKKAGFDNIKHD
DSKDEYSLDKPEGAALSISPDPGTTIKHNDEVTVTLSKGPMPVSMPDVVGKTKDEMQAAF
DELKLTANITEQFDDKIAAGEVISASQDAGAQLKWGDSVDVVVSKGPETTVMPNVVGQQY
DAAAAQLKKLGFTVKKSAPLGDITHVVRIQSPNAGETVRLRDENGTPTVITLTVV
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaacgagcccacacagatgattgagggacgctaccgcatcgtgcgcaatatc
gccgaaggcggcatggccaccgtgtatgaggcggtcgatgagcgtttgggccgtactgtg
gcgatcaaggtcatgcacacgcagctggcacagggaccgcatcgagatcagttcgtggag
cggttccgccgtgaagccaattcagccgcggccatcgcaaacccgcatatcgttcaggtt
tacgacaccggtgagttcaatggccttgattttttggttatggaatatgtgcatggcgtc
aatctgcgccatgagatgaacgttcaaggcacattctccgtccgcgagacactgcgcgtt
atcgcggaaacgttggacggcttggcttcggcacatcgtgcgggcgtggtacatcgtgat
atcaaacccgaaaacatcctgatcaacgatcgcggccacgttcaaatcactgattttggt
ctggccaaggccgccagccaagcaacgctgagttccaccggcatgctgttgggcactgcg
gcctatctggctcctgaaatgatcgagaataatcaggccaccccacaaggcgatttgtat
tccgtgggcatcatggcttgggagatgcttgccggtaaagtgccttttgactccgataat
ccggtcacgcttgtgttcaagcatgttcatgaggatgtgccgtccatagccacggtctgt
ccggatatcgatccatccgtggcctcgttcattgtccacttgaccgctcgccaggtcgag
gctcgtcccgcgaacggctccgaggccgcccaggaacttcgtcaattggccgccaaactc
cctatggaggcatggcaatatcgtttgcatgtcgagtctgcggatgccgccagaaccgat
gctaccgcaccggctttggttggcggactggtttcgccggagaccgctcctaggcagagc
tctgacacgcccccggagcctcccaccgccccgaccaccgctttcaatgcgtcttccgca
cgagaagaccttacgcaagtcatgcccaaccccggtaatgagacaacgattctggcaaag
accggggatgatttcgaccaggtgctcgccgctgaagacgatgccggaagccccgatgcc
aagccaacggacggaaagcgcaacaagaagccgctcatcatcgccttggtgattgttctg
gtactggctgtagctgccggaaccggcgcatggtggtggttcgcaggtcccggcagctat
tggagtgtgcccaagcccgatgacgtgacgtgtaaggaggacaccgagtgctcgttgtcc
ggtgctgactgggccacgtatgagagcacgctgaaggtggcaggaatcccctataaggcc
gagaagcagtacagcgacaacatcgccgaaggcaagatcgtctccgcctcggtgagtgaa
aacaacgctgttgtaggcagtcacgtcagcaagcgtcacaatcagcaactgacggtgacg
gtctcgcagggtgtacacatggtcaccattccgaacgatgtcctcgatacgaattccgcg
aacggcaaggaccctctgtccgcgttgaagaaagcgggcttcgacaacatcaagcacgat
gattcgaaggacgagtattcgctggataagccggaaggcgcagcgctcagcataagcccc
gaccccggcaccacgatcaagcacaatgatgaagtgacagtgacgctcagcaagggtccc
atgcctgtcagcatgcctgacgtagtcggcaaaaccaaggatgagatgcaagcggcattc
gatgagctcaagctcaccgccaacatcaccgaacaattcgatgacaagattgccgcaggc
gaggtcatctccgcttcccaagacgctggcgcgcagctcaaatggggcgacagcgtagac
gtggtggtatccaagggacctgagaccacggtgatgccgaatgtggtgggtcagcagtat
gacgcggcagccgcacagctgaagaagctgggcttcactgtcaagaaatccgcaccgctg
ggcgacattacccatgtggtgcgtatccagagtcccaatgccggagaaacggtgcgtcta
cgcgacgaaaacggcactccaaccgttatcacgctgactgtggtgtga

DBGET integrated database retrieval system