KEGG   Borreliella bissettii: BbiDN127_0241Help
Entry
BbiDN127_0241     CDS       T01593                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bbs  Borreliella bissettii
Pathway
bbs00564  Glycerophospholipid metabolism
bbs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbs00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BbiDN127_0241
Enzymes [BR:bbs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BbiDN127_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 GIDA Thi4 Pyr_redox_3 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEL18426
UniProt: G0AL50
LinkDB All DBs
Position
247077..248660
Genome map
AA seq 527 aa AA seqDB search
MEEYLNFMDNNKETKLKDLENQEFDLIIIGGGSTGLGIAVDAITRGYKTILIEKFDYAKG
TSSRSSKLIHGGVRYLAQWNISLVKEALHEKAILEKNAPHLINECALITPIYNVLEIPYY
YFGLIYYHNLMGKEKTAKYKTKLLSKTSTIEKAPNIKAEGLKCSVLYYDDSFDDARMAIT
LLRTFTEKGGIALNYTELKKFNKENGKLSGVLIQNKLSKEQISLKSKCIINATGIFSDEI
RRLDDEKALNIIKPSQGSHLIIKKDKFPKNHAILIPKTSDNRILFAIPWYDSVVCGSTDI
PIKEIEEEPKRFEEEIDFIINNLNSYLNIKIEKSDVKSVYTGIRPLIMDPKAKGNTSKIS
RNEKIFISDSNLITIAGGKYTTYRKMAEKTLLKAIEKNLIPNCAPTTEDLKLHGYLKKEE
AMKIPEPFRAYGSDFEILKNMRGFDKKIHENLDLNEAQIAFSIDFEQAKTIEDVLARRTR
SLPLNPQATIEAAPRVAEIMMKKLNKSEEWKNEQIKSFLEISKKYII
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatatttaaatttcatggataataacaaagaaacaaaattaaaagatcttgaa
aatcaagaatttgatcttataataattgggggaggctcaacagggcttggcattgcagta
gacgcaattacacggggatacaaaacaatacttatagaaaaatttgattatgcaaaaggc
acttcctctaggtcaagcaaattaattcacggcggagtaagatatttggcccaatggaat
atttctttagttaaagaagctttacacgaaaaagccattcttgagaaaaatgcaccccat
ttaattaacgaatgcgcacttatcactcctatttataatgttttagaaataccttattat
tattttggattaatttattaccacaatcttatgggtaaagaaaaaacagccaaatacaaa
actaaattactgtccaaaacatctaccattgaaaaagctcctaatattaaagcagaaggc
cttaaatgctctgttctatattacgacgattcattcgatgatgctagaatggcaataaca
ttgttaagaacttttacagagaaagggggtattgctcttaactatacagaacttaaaaaa
ttcaacaaagaaaacggaaaactttcgggggttctcatacaaaacaaattgtcaaaagaa
caaatttcattaaaaagcaaatgtataataaacgcaacaggaatattttcagatgaaata
agaaggttggatgatgaaaaagctttaaacattatcaaaccttcccaaggtagccattta
ataatcaaaaaagacaaatttcccaaaaatcatgcaatattaatacctaaaactagtgat
aataggattttattcgctattccttggtatgatagtgttgtttgtggaagcactgacatt
ccaataaaagaaatagaagaagaacctaaaagatttgaagaagagattgactttataata
aataatttaaatagctatttaaatattaaaatagaaaaatctgatgtaaaaagcgtatac
accggaataaggccattaataatggatccaaaagctaagggaaacacttcaaaaatctca
agaaatgaaaaaatatttatatcagattcaaatcttattacaatagcggggggcaaatat
actacatacagaaaaatggcagaaaaaaccttgcttaaggcaatagaaaaaaatttaata
ccaaattgtgcaccaactacagaagatttaaagttacacggttatcttaaaaaagaagag
gcgatgaaaattcctgaaccttttagagcttatggcagtgactttgaaattctaaaaaat
atgcggggttttgacaaaaagatacacgaaaacttagatttaaatgaagctcaaatagct
ttttcaattgactttgaacaagccaaaacgattgaagatgttttagcaagaagaacaaga
tcactgcctttaaatcctcaagccacaattgaggctgctcctagagttgctgaaataatg
atgaaaaaattaaataaatctgaagagtggaaaaatgaacaaataaaaagctttttagaa
ataagtaaaaaatatataatttaa

DBGET integrated database retrieval system