KEGG   Bradyrhizobium sp. BTAi1: BBta_0452Help
Entry
BBta_0452         CDS       T00528                                 

Gene name
cbbS
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00630  Glyoxylate and dicarboxylate metabolism
bbt00710  Carbon fixation in photosynthetic organisms
bbt01100  Metabolic pathways
bbt01120  Microbial metabolism in diverse environments
bbt01200  Carbon metabolism
Module
bbt_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bbt_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
bbt_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BBta_0452 (cbbS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BBta_0452 (cbbS)
Enzymes [BR:bbt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BBta_0452 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABQ32738
RhizoBase: BBta_0452
UniProt: A5E994
LinkDB All DBs
Position
453109..453528
Genome map
AA seq 139 aa AA seqDB search
MRITQGCFSFLPDLTDEQITKQVQYCLEKGWSVNIEFTDDPHPRNTYWEMWGLPMFDLRD
AAGVMMELAKCRRVYADRYIRLSAFDSSHGWESVRLSFIVNRPKEEPGFRLDRQEVAGRR
IRYSTHAYVTDRPEGQRYG
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcacccagggttgcttctccttcctgccggacctcaccgacgagcaaatcacc
aagcaagtgcaatactgcctggagaaaggctggtcggtgaacatcgagttcaccgacgac
ccgcatccccgcaacacttattgggaaatgtggggcctgccgatgttcgacctcagggac
gccgccggcgtcatgatggaactcgccaaatgccggcgcgtctatgccgaccgctacatc
cgcctctccgccttcgattcgagccatggctgggagtcggtgcgtctctcctttatcgtt
aaccggccgaaggaggagcctggcttccggctcgaccgtcaggaggtggcgggacggcgc
atccgatactcaacacatgcctatgtgaccgaccgtcccgaaggtcagcgctacggctga

DBGET integrated database retrieval system