KEGG   Bradyrhizobium sp. BTAi1: BBta_0817Help
Entry
BBta_0817         CDS       T00528                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00071  Fatty acid degradation
bbt00280  Valine, leucine and isoleucine degradation
bbt00281  Geraniol degradation
bbt00310  Lysine degradation
bbt00362  Benzoate degradation
bbt00380  Tryptophan metabolism
bbt00410  beta-Alanine metabolism
bbt00640  Propanoate metabolism
bbt00650  Butanoate metabolism
bbt00903  Limonene and pinene degradation
bbt00930  Caprolactam degradation
bbt01100  Metabolic pathways
bbt01110  Biosynthesis of secondary metabolites
bbt01120  Microbial metabolism in diverse environments
bbt01130  Biosynthesis of antibiotics
bbt01200  Carbon metabolism
bbt01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BBta_0817
   00650 Butanoate metabolism
    BBta_0817
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBta_0817
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBta_0817
   00310 Lysine degradation
    BBta_0817
   00380 Tryptophan metabolism
    BBta_0817
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BBta_0817
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BBta_0817
   00281 Geraniol degradation
    BBta_0817
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBta_0817
   00930 Caprolactam degradation
    BBta_0817
Enzymes [BR:bbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BBta_0817
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BBta_0817
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BBta_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH UDPG_MGDP_dh_N NAD_binding_2 DAO FAD_binding_3 F420_oxidored ApbA Pyr_redox_2 Sacchrp_dh_NADP NAD_binding_8 Pyr_redox NAD_binding_7 GIDA
Motif
Other DBs
NCBI-ProteinID: ABQ33079
RhizoBase: BBta_0817
UniProt: A5EA85
LinkDB All DBs
Position
844278..846491
Genome map
AA seq 737 aa AA seqDB search
MAFKNFKLETDADGIALITWDIPGRSMNVLDETSTNELEALVKETTADAAIKGVVITSAK
EAFCAGADLSMLEGMNRLYADVLKSKGEEAANQMLFDTSRRFSQINRAMETSGKPWVAAI
NGLALGGGFEITLSCHYRVAAENPKTRLGLPEIKVGLFPGAGGTQRVPRIVQPQDAMNLL
LKGEALTLDKAKALKLVDAIVPAADLIKAAKDWIKGGGKAVQPWDEKGFKLPGGPVFSKN
GMMMFPAGNAIYRRETYDNYPAARAIMSCVYEGLQLPIDAALRVESRYFTKILRSKEAAA
MIRSLFLSMQELNKGARRPADVPATKLKKIAVIGAGFMGASVGYVSARGGLDVVLIDRDQ
ESADKGKAHAQSVIDGLVKKGRAKPSEAEAIMGRITATADYAALKDCDLVIEAVFEDRKV
KAETYAKAQAYLKDGAIFASNTSTLPITSLAEEFKDQGRFIGIHFFSPVEKMMLVEIIMG
KATGDVALATALDYVRSIGKTPIVVNDSRGFFANRCVMRYIAEGNEMFLEGVPPALIENA
AKMAGMPVGPLSLSDEVALDLGLKIMKATEHDLGPNAINQDHKKLMVELVEKQGRFGRKN
GKGFYDYPEKGKGQKSLWPDLAKLQPKHLDPDTLDVEELKQRFLVVQAVEAARTVEDHVI
TDVREADVGSILGFGFAPFTGGTLSYIDFMGTKKFVELCHTFTAKYGSRFAPPKLLEEMA
AKGETFYGRFPPKKAAA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggccttcaagaacttcaaactggaaaccgatgccgacggcattgcgctgatcacctgg
gacattccgggccgttcgatgaacgtgctcgacgagacctcgacgaatgagctcgaggct
ctcgtgaaggaaaccaccgccgatgccgccatcaagggcgtcgtcatcacctcggccaag
gaggcgttctgcgccggcgccgatctgtcgatgctcgagggcatgaaccgcctctatgcc
gacgtgctgaagagcaagggcgaggaagccgccaaccagatgctgttcgacaccagccgg
cgcttctcgcagatcaaccgggcgatggaaacgtccggcaagccgtgggtcgccgcgatc
aacggcctcgcgctcggcggcggcttcgagatcaccctgtcgtgccactaccgcgttgcg
gccgagaatccgaagacgcggctcggcctgcccgagatcaaggtcggcctgttccccggc
gccggtggcacccagcgcgtgccgcgcatcgtgcagccgcaggacgccatgaacctgctg
ttgaagggcgaggcgctcacgctcgacaaggccaaggcgctgaagctggtcgacgcgatc
gtgccggcggcggatctcatcaaggcggccaaggactggatcaagggcggcggcaaggcg
gttcagccgtgggacgagaagggcttcaagctgcccggcggcccagtgttctccaagaac
ggcatgatgatgttcccggccggcaacgccatctaccgccgcgagacctacgacaattat
ccggcggcgcgcgccatcatgagctgcgtctatgaaggcctgcagttgccgatcgacgcc
gcgctgcgcgtcgaatcgcgctacttcaccaagatcctgcgctcgaaggaagccgcggcc
atgatccgcagcctgttcctgtcgatgcaggaattgaacaagggcgcgcgtcgccccgcg
gacgtgccggcgaccaagctcaagaagatcgccgtgatcggcgccggcttcatgggcgcc
tccgtcggctacgtctcggcccgcggcggcctcgatgtcgtgctgatcgatcgcgaccag
gagagcgccgacaagggcaaagcgcatgcgcagagcgtgatcgacggcctggtcaagaag
ggccgcgccaagccaagcgaggccgaggcgatcatgggccgcatcaccgcgaccgccgac
tacgccgcgttgaaggattgcgacctcgtgatcgaggccgtgttcgaggaccgcaaggtc
aaggccgagacctacgccaaggcacaggcctatctgaaggacggcgcgatcttcgcttcc
aacacctcgaccttgccgatcacctcgctggccgaggagttcaaggaccagggtcgcttc
atcggcatccacttcttctcgccggtcgagaagatgatgctggtcgagatcatcatgggc
aaggcgaccggcgacgtcgcgctggcgaccgcgctggactatgtccgctccatcggtaag
accccgatcgtggtcaacgactcccgcggcttcttcgccaatcgctgcgtgatgcgctac
atcgccgagggcaacgagatgttcctcgaaggcgtgccgccggcgctgatcgagaacgcc
gccaagatggccggtatgccggtcggaccgctgtcgctgtcggacgaggtcgcgctcgac
ctcggtctgaagatcatgaaggcgaccgagcacgatctcgggcccaacgcgatcaaccag
gaccacaagaagctgatggtcgagctggtcgagaagcagggccgcttcggccgcaagaac
ggcaagggcttctacgattatcccgagaagggcaagggtcagaagagcctgtggccggat
ctggccaagctgcagccgaagcatctcgatccggatacgctggatgtcgaggagctgaag
cagcgcttcctggtggtgcaggcggtggaagccgcgcgcaccgtcgaggaccatgtcatc
accgacgtgcgcgaggccgatgtcggctcgatcctcggcttcggcttcgcgccgttcacc
ggcggcacgctgtcctatatcgacttcatggggacaaagaagttcgtcgagctgtgccac
accttcacggcgaaatacggctcgcgcttcgccccgccgaagctgctggaggaaatggcc
gccaagggcgaaaccttctacggccgcttcccgccgaagaaggcggcggcctga

DBGET integrated database retrieval system