KEGG   Bradyrhizobium sp. BTAi1: BBta_2221Help
Entry
BBta_2221         CDS       T00528                                 

Gene name
glpD
Definition
(GenBank) homodimeric glycerol 3-phosphate dehydrogenase (quinone)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00564  Glycerophospholipid metabolism
bbt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBta_2221 (glpD)
Enzymes [BR:bbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BBta_2221 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 FAD_binding_2 Pyr_redox FAD_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABQ34400
RhizoBase: BBta_2221
UniProt: A5EE06
LinkDB All DBs
Position
2296377..2297921
Genome map
AA seq 514 aa AA seqDB search
MERIYDLAIVGGGVNGCGIARDAAGRGNSVFLCEMNDLASGTSSWSTKLVHGGLRYLEYY
EFRLVREALIEREILWQIAPHIIRPLRFVLPHHSGLRPAWLLRLGLFLYDHLGGRKLLPP
TRSVNLRSDEVGRPLIAGRYSTGFEYSDCFVDDARLVVLTARDAADRGAVIRTRTRATAI
RQDGSNWLVTTENTQTGERETIKARALVNAAGPWVEQVLSTGAGVNAKAKVRLVQGSHIV
VRKLYDHDRAYIFQNADGRIIFAIPYQQDFTLIGTTDRDYQGDPAKVKATDEEIAYLCAA
LGEYIAKPVTPADVVWSYSGVRPLYDDGASEAKAATRDYVFELDTPGGLPLLSIYGGKIT
TYRRLSEEALERLAPYLKGAKADEGWTGKAALPGGDMQVQAVATLVADLGKTYPFLSDAH
AKRIAHAYGTRAQTMLAGATSLADLGQDFGGTLTEREVRYLMTNEWALTAEDIVWRRSKL
GLRMSAAEIAALDAWITAHRERAAVTAREAGGRA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
ttggagcggatctacgacctcgccattgtcggaggcggcgtgaatggctgcggcatcgcg
cgcgatgcggccggacgcggaaattccgtttttctgtgtgagatgaacgatctggcgagc
ggaacctcgtcctggtcaaccaagctcgtgcatggcggcttgcgctatctcgaatattac
gaattccgcctggtgcgtgaggcgctgatcgagcgcgagattctctggcagatcgcgccc
cacatcatccgcccgctgcgtttcgtgctgccgcatcattccggcctgcgcccggcctgg
ctgctgcggctcggcctgttcctctacgaccatctcggcggccgcaaactgctgccgccg
acacgctcggtgaatctgcgcagcgatgaggtcggccgtccgctgatcgccggacgctat
tccaccggtttcgaatattccgactgttttgtcgatgatgcgcgcctcgtggtgctgacc
gcgcgcgatgccgccgaccgcggggccgtcatccgcacgcgcacgcgggcgaccgcgatc
cggcaggacggcagcaactggcttgtcaccaccgagaacacccagaccggcgagcgcgag
accatcaaggcgcgtgcgctggtcaatgccgccggcccgtgggtggagcaggtgctttcg
accggcgccggtgtcaatgcaaaagcgaaagtgcgcctggtgcagggctcgcatatcgtg
gtgcgcaagctctatgatcacgaccgcgcctacatcttccagaatgccgacggccgcatc
atcttcgcgattccctaccaacaggatttcacgctgatcggcaccaccgatcgcgactat
cagggcgatccggccaaggtgaaggcgaccgacgaggaaatcgcctatctctgcgccgcg
ctcggcgagtacatcgccaagccagtgacgccggctgacgtggtgtggagctattccggc
gtgcgcccgctgtatgacgacggcgccagcgaggccaaggcggcgacgcgcgactacgtg
ttcgagctcgatacgcccggcggcctgccgctgctctcgatctatggtggcaagatcacc
acctaccggcgactgtcggaggaggcgctggagcgcctggcgccgtatctgaagggcgcg
aaggcggacgaaggctggaccggcaaggccgcgctgcccggcggcgacatgcaggtgcag
gccgttgccacgttggtcgccgatctcggcaagacctatccgttcctgtcggatgcacat
gcgaagcgcatcgcgcatgcctatggtacgcgggcccagaccatgctcgcgggtgcgaca
tctttggccgatctcggccaggacttcggtggcaccttgacggagcgcgaagtcaggtac
ctgatgacgaatgagtgggcgttgacggccgaggacattgtgtggcggcgatcgaagctg
gggttgcgaatgtcggcggctgagatcgcagcgctcgatgcgtggatcacagcccaccgc
gagcgcgctgccgtgacggcgcgtgaagccgggggacgcgcatga

DBGET integrated database retrieval system