KEGG   Bradyrhizobium sp. BTAi1: BBta_2819Help
Entry
BBta_2819         CDS       T00528                                 

Gene name
nrtB
Definition
(GenBank) nitrate transport permease protein (nrtB)
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00910  Nitrogen metabolism
bbt02010  ABC transporters
Module
bbt_M00438  Nitrate/nitrite transport system
bbt_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BBta_2819 (nrtB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BBta_2819 (nrtB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbt02000]
    BBta_2819 (nrtB)
Transporters [BR:bbt02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    BBta_2819 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABQ34948
RhizoBase: BBta_2819
UniProt: A5EFK4
LinkDB All DBs
Position
2914077..2914991
Genome map
AA seq 304 aa AA seqDB search
MSMPALTSDSAPKIVPTASAPTAASASVVTMTPKQPPKAERYVKMAREAAVRVVPPLIVL
ALFLIVWELLCRRAGSALPPPSRVFSDTRELIFDPFFDHGGIDKGLFWHLEASLRRVAIG
YAIAAIVGVAVGTLIGQSVWAMRGLDPIFQVLRTIPPLAWLPLSLAAFRDGQPSAIFVIF
ITSVWPIIINTAVGIRNIPQDYRNVAAVVQLNPLEFFAKIMIPAAAPYIFTGLRIGIGLS
WLAIVAAEMLIGGVGIGFFIWDAWNSSHISEIVLALFYVGIIGFVLDRLIATVGKVVTRG
TATN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgccagcgttgacgagcgatagcgcgcccaagatcgtgccgacggcatccgcg
cccacggccgcttctgcgtccgtggtgacgatgacgccgaagcagccgccgaaggctgag
cgctatgtgaagatggcccgagaggccgccgtgcgcgtggtgccgccgctgatcgtgctg
gcgctgttcctcatcgtctgggagctgttgtgccgccgcgccggctcggcgctgccgccg
ccatcgcgcgtgttttcggatacgcgcgagctgatcttcgatccgttcttcgaccatggc
ggcatcgacaagggcctgttctggcatctcgaggcgagcctccgccgcgtcgcgatcggc
tatgccatcgccgccatcgtcggcgtcgcggtcggcacgctgatcggccagtcggtctgg
gcgatgcgcgggctcgatccgatcttccaggtgctgcgcacgatcccgccgctggcctgg
ctgccgctgtcgctggcggcgttccgcgatggccagccgtcggcgatcttcgtcatcttc
atcacctcggtgtggccgatcatcatcaacactgcggtcggcatccgcaacattccgcag
gactatcgcaacgtcgccgcggtggtgcagctcaatccgcttgagttcttcgccaagatc
atgatccccgcggccgctccctacattttcaccggcctgcgcatcggcatcggcctgtcc
tggctcgccatcgtcgccgccgagatgctgatcggcggcgtcggcatcggcttcttcatc
tgggacgcgtggaattcctcgcatatcagcgagatcgtcctggcgctgttctatgtcggc
atcatcggcttcgtgctcgatcgcctgatcgcgaccgtcggcaaagtcgtcacccgcggc
accgcgacgaactga

DBGET integrated database retrieval system