KEGG   Bradyrhizobium sp. BTAi1: BBta_5502Help
Entry
BBta_5502         CDS       T00528                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
bbt  Bradyrhizobium sp. BTAi1
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BBta_5502
Enzymes [BR:bbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     BBta_5502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ABQ37463
RhizoBase: BBta_5502
UniProt: A5EMR9
LinkDB All DBs
Position
5717317..5719455
Genome map
AA seq 712 aa AA seqDB search
MEVTKCPRPAWIHAAWSTAAALCVAVTMPADHATAEELSADRIKAAISAVDSTMIKANTA
TSKDWPTIGLDYAETRFSRLDKINTDNVKDLGLAWSYNLDSERGVEATPVVVDGIMYQTA
SWSVVHAIDARTGKKIWTFDPGVKRELGYKGCCDVVNRGVAVYKGKVFVGAYDGRLIALD
AATGQKVWEKDTLIDHEHSYTITGAPRAFNGKVVIGQGGAEYGARGYITAYDSETGNQLW
RWFTIPGDPSKPFEDESMATAAKTWDPSTKYWINGGGGTPWDTITYDPDLNMVYLGTGNG
APWNRKIRSPSGGDNLYLASIVALNADTGKYVWHYQETPGDHWDYTSTQPMILADITIDG
TPRKVILHAPKNGFFFVIDRTNGKFISAKNFVDVNWATGYDANGRPIEVPAARGDDPYDS
VPGPYGAHNWHPMSFNPQTGLVYLPAQNIPVNLTPEKSFVNNAPTPGKFGGVTAWNLGFM
LNATPPKAPAFGRLLAWDPVQQKEVWRIEHVSPWNGGTLTTAGNLVFQGTADGRFVAYDA
RNGKMLWETPTGTGVVAAPSTYMIDGVQYVSIAVGWGGVYGLAQRATELRTPGTVYTFAV
GAKAKLPEFVKYQTEGLLQGVKYDPKDVPEGTALYIAACATCHGVPGVDKGGNIRNLGYV
PAEEITKLKDIVFNGPFRERGMPDFTDKLKEEDVVKIQAFIQATADAIRPKK
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgacgaagtgcccgcgtccggcctggattcatgctgcctggagcacggcagcg
gccttatgtgtcgctgtgacgatgccggcagaccacgcgactgcggaggagttgtcggcc
gatcgcatcaaggcagcgatctccgccgtcgacagcaccatgatcaaggccaataccgcg
acatcgaaggactggccgacgatcggcctcgattatgccgagacgcgcttcagcaggctc
gacaagatcaacaccgacaacgtcaaggatctggggctcgcgtggagctacaatctcgac
tccgagcgcggcgtcgaagccacgccggtcgtcgtcgacggcatcatgtatcaaaccgcc
tcgtggagcgtcgtccatgcgatcgatgcccgcaccggcaagaagatctggaccttcgat
cccggcgtgaaacgcgagctgggctacaaaggatgctgcgacgtcgtcaatcgcggcgtc
gcggtctacaagggcaaagtgttcgtcggcgcctatgacggccgactgatcgcgctcgat
gctgcgaccggtcagaaggtctgggagaaggacacgctgatcgaccacgagcattcctac
accatcaccggcgcgccgcgcgccttcaacggcaaggtcgtgatcggccagggcggcgcg
gaatatggcgcgcggggctacatcaccgcctatgactccgagaccggcaatcagctatgg
cgctggttcaccatccccggcgatccatcgaagccgttcgaggacgagtcgatggcgacg
gccgccaagacctgggatccgtcgaccaaatattggatcaatggtggcggcggcacgccg
tgggacacgatcacctacgaccccgacctcaatatggtctatctcggcaccggcaacggc
gcgccgtggaatcgcaagatccgcagcccgtccggcggcgacaatctctacctcgcctcg
atcgtcgcgctgaatgccgacaccggcaaatatgtctggcactatcaggagacgcccggc
gatcactgggactacacctcgacccagccgatgatcctcgccgacatcaccatcgacggc
accccgcgcaaggtgatcctgcacgcgccgaagaacggcttcttcttcgtgatcgaccgc
accaatggcaagttcatctcggccaagaacttcgtcgatgtgaactgggccaccggctat
gacgccaatggccgtccgatcgaagtgcccgccgcgcgcggcgatgatccctacgactcc
gttcccggcccctacggggcccacaactggcacccgatgtcgttcaatccgcagacgggg
ctggtgtatctcccggcgcagaacattccggtcaacctcacaccggagaagagcttcgtg
aacaatgcgccgacgccgggcaagttcggcggggtcacggcgtggaatctcggcttcatg
ctgaacgcgacgccgccgaaggccccggcgttcggacgcctactggcctgggatccggtg
cagcagaaggaagtctggcgcattgagcacgtctcgccttggaatggcggcacgttgacg
acggctggcaatctggttttccagggcaccgccgatggccgcttcgtggcctatgatgcg
cggaacggcaagatgctgtgggagacgcccaccggcaccggcgtcgtcgcggccccctcg
acctacatgatcgacggggtgcaatatgtctcgatcgccgtcggctggggcggtgtctac
gggctggcgcagcgcgccaccgaactgcggactccgggcacggtctacacctttgccgtc
ggcgccaaggccaagctgccggagttcgtgaagtaccagaccgagggactgctgcagggc
gtgaaatatgatcccaaggacgtgcccgagggcaccgcgctttacatcgccgcctgcgcc
acctgccacggcgtgcccggcgtggacaagggcggcaacatccgcaatctcggctacgtg
ccggccgaagagatcaccaagctgaaggacatcgtcttcaacggaccgttccgcgagcgc
ggcatgcccgacttcaccgacaagctcaaggaggaggacgtggtgaagatccaagccttc
atccaggccacggccgacgccatccggccgaagaagtag

DBGET integrated database retrieval system