KEGG   Bradyrhizobium sp. BTAi1: BBta_6278Help
Entry
BBta_6278         CDS       T00528                                 

Definition
(GenBank) putative maleylacetoacetate isomerase (MAAI) (Glutathione S-transferase)
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BBta_6278
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbt02000]
    BBta_6278
Enzymes [BR:bbt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BBta_6278
Transporters [BR:bbt02000]
 Other Transporters
  Pores ion channels [TC:1]
   BBta_6278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N GST_C_4 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ABQ38197
RhizoBase: BBta_6278
UniProt: A5EPV3
LinkDB All DBs
Position
complement(6525035..6525688)
Genome map
AA seq 217 aa AA seqDB search
MAKATLTISSKNYSSWSLRGWLLAKFAGLDFDEVIVGPDDASARAEILLLSSSILVPCLR
HEGATIWDTLAIGEYLNEIFPGAGLLPADRIQRAHCRSISGEVHSGFTTLRASLPVNLKG
HFPGFKVWTRAQADIDRIWAIWRDCLEKSGGPFLFGARGMADAMYAPVVTRFVTYDVKLE
PQLKAYADLIMAMPEMREWIAAAKAEPEEIEELEVEY
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggcgacattgaccatcagcagcaagaattattcatcatggtcgctgcgcggt
tggctgctggccaagtttgccggcctcgactttgatgaggtgattgtcggtccggacgat
gcgtcggcgcgggctgagatcttgctgctgtcctcctcgatcttggtgccgtgcctcagg
catgagggcgccacgatctgggatacgctggcgatcggggaatatctcaacgagatcttc
ccgggcgcgggcctgctgccggccgatcgcatccagcgcgcgcattgccgctcgatctca
ggtgaagtccattccggcttcaccacgttgcgggcctcgctgccggtcaatctcaagggg
cactttcccggcttcaaggtctggacccgtgcgcaagccgatatcgaccgcatctgggcg
atctggcgcgactgcctggagaagtcgggcggaccgtttctgttcggcgcgcgcggcatg
gccgatgcgatgtatgcgcccgtggtgacgcgcttcgtcacctatgacgtgaagctcgaa
ccgcagctgaaggcctatgccgatctcatcatggcgatgcccgagatgcgcgaatggatc
gcggccgcgaaggcggagcccgaggagatcgaggagctcgaggtcgaatattag

DBGET integrated database retrieval system