KEGG   Bradyrhizobium sp. BTAi1: BBta_7782Help
Entry
BBta_7782         CDS       T00528                                 

Definition
(GenBank) putative ATP-dependent DNA ligase
Organism
bbt  Bradyrhizobium sp. BTAi1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ABQ39612
RhizoBase: BBta_7782
UniProt: A5ETW8
LinkDB All DBs
Position
complement(8168179..8169234)
Genome map
AA seq 351 aa AA seqDB search
MQLIPGEHGRCRCIGLDVMAGMLSAALPEEVRTGARKRRQPSWIAPMLASLTQERFSRED
WLFEPKWDGERCLVFSHGTELELLSRNRTRLNERYPELAPAFNQCAMNSFIADGEIVAFT
GGITSFMQLQKRMQVENPSRSLLRQVPVYMYLFDLLYWNGYDLRRVPLRHRKALLHDAFP
FGRRLRFTAHREKDGEAYYREACRKGWEGIIAKNGNSQYVSKRTRDWLKFKCEQGQEFVV
GGYTEPQGHRIGFGDLLLGVYRDERLHYAGKVGTGFDSAMLKVLAQRLRSIETNVSPFAD
YDIPQRGVYWVKPELVAQIAFTEWTKDGRLRHPRFRGLRDDKLPSEVIREG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcattcctggtgagcacgggcgctgccgctgcataggattagatgtcatggca
ggcatgctttcggccgcgctacctgaagaggtaaggaccggggcacgcaagaggcggcaa
ccaagttggatagcgccgatgctggcgagcttgacgcaagagcgattttccagggaggac
tggctcttcgaaccgaaatgggacggcgagcgctgcctggtgttcagtcacggcaccgaa
ttggaattgttgtcacgtaacaggacacgtctgaatgaaagatatcccgagcttgcaccg
gcattcaatcagtgtgcgatgaactctttcattgctgatggtgaaatcgttgcattcacg
ggcggcataacgagcttcatgcagctccaaaagcgcatgcaggtcgagaatccatctcgc
tccttgttgcgacaggtgccggtctatatgtacctgttcgaccttctgtactggaacggt
tacgatttgcggcgcgtaccccttcggcatcgtaaagcactgcttcacgacgcattccca
ttcgggcgccgattgagattcaccgcgcatcgtgagaaggatggcgaagcctattaccgc
gaagcgtgccgcaagggctgggaagggattatcgctaagaatggcaacagccaatatgtc
tcaaaacgaacgcgagactggctgaagttcaagtgtgagcaaggtcaggagtttgttgtc
ggcggatacacagagccccagggacatcggattggcttcggggatttgctgctaggagtg
taccgagacgagcgacttcattatgcgggaaaggttggaaccggattcgatagcgcgatg
ttgaaagttcttgcgcagcgacttcgaagtatcgaaacgaatgtctcgccatttgccgac
tacgatatcccgcaacgaggcgtctactgggtcaaaccggagctcgtcgcacagattgcc
ttcacggaatggaccaaggatggccggctccgccatccacggtttcgcggtttgcgtgac
gacaagctgccgtcagaagtgatacgggagggttga

DBGET integrated database retrieval system