KEGG   Borreliella burgdorferi B31: BB_0619Help
Entry
BB_0619           CDS       T00012                                 

Definition
(RefSeq) DHH family protein
  KO
K06881  bifunctional oligoribonuclease and PAP phosphatase NrnA [EC:3.1.3.7 3.1.13.3]
Organism
bbu  Borreliella burgdorferi B31
Pathway
bbu01100  Metabolic pathways
bbu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BB_0619
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bbu03400]
    BB_0619
Enzymes [BR:bbu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     BB_0619
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.3  oligonucleotidase
     BB_0619
DNA repair and recombination proteins [BR:bbu03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Others
    BB_0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHHA1 DHH MHC_I
Motif
Other DBs
NCBI-GeneID: 1195468
NCBI-ProteinID: NP_212753
UniProt: O51564
LinkDB All DBs
Position
645719..646681
Genome map
AA seq 320 aa AA seqDB search
MRDVINFIKKYNNFVIIGHKDPDFDCIGSSLALSSFLSRIGKNSILLNEGPFIRKEIVPF
KDKFLSEWPNIEISEYSVIILDCSILDRIGDEFIFYVKNMPTLVIDHHMSGEKLECEGYI
DPFAPSTTFLIEKLIREFGHDLTKEEAWYILVGFCTDTGFFKFISRSDPEPFEMVARLVS
KGISLKEVYSYIETTKSLKSIETLKLMLNSLESYWNGKVLFTFLSSSSSGKDGGVSGVNE
LFYMILSNVENNEILGILKEMEDGSIIVGLRSKDSFDVGKLAEDFGGGGHKNASGFRIKQ
GSLEIVKNRMLAYIKDNIYL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagagatgttattaattttattaaaaaatataataattttgttattattgggcacaaa
gatcctgattttgattgtataggttcttctttagctttatcctcttttctctcaagaatt
ggtaaaaattctattttgttaaatgaaggtccttttattagaaaagaaatagttcctttt
aaggataagtttttatctgaatggcccaatattgagatttcagagtattcagttattatt
ttagattgctcgattttagataggataggtgatgaatttatcttttatgtaaagaatatg
cctactttagtaatcgatcatcatatgtctggtgaaaaattagaatgtgagggctatatt
gatccttttgcaccttctactacttttttaattgaaaaattgataagagagtttggacat
gatcttacaaaagaagaagcttggtatattttagtaggattttgtactgatactggtttt
tttaaatttatttcaagaagtgatccagagccttttgaaatggttgcaagactggtttca
aaaggaataagccttaaagaagtttatagctatatagaaaccaccaaaagcctaaaatca
atagaaactcttaagttaatgcttaacagtcttgaatcttattggaatggaaaggttttg
tttacatttttatcttcttctagctctggcaaagatggtggagttagtggggttaatgag
cttttttatatgattttaagcaatgttgagaataatgaaattttaggcattttaaaggaa
atggaggatggttcgattatagttgggctaagatctaaagattcttttgatgttggaaaa
ttggcagaagattttggaggcggtgggcataaaaatgccagtgggtttagaatcaaacaa
ggttctctagagattgtaaaaaatcgaatgctagcatacattaaggataatatttattta
taa

DBGET integrated database retrieval system