KEGG   Bubalus bubalis (water buffalo): 102389416
Entry
102389416         CDS       T05912                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04010  MAPK signaling pathway
bbub04060  Cytokine-cytokine receptor interaction
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04218  Cellular senescence
bbub04350  TGF-beta signaling pathway
bbub04390  Hippo signaling pathway
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub05140  Leishmaniasis
bbub05142  Chagas disease
bbub05144  Malaria
bbub05145  Toxoplasmosis
bbub05146  Amoebiasis
bbub05152  Tuberculosis
bbub05161  Hepatitis B
bbub05166  Human T-cell leukemia virus 1 infection
bbub05200  Pathways in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05220  Chronic myeloid leukemia
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05321  Inflammatory bowel disease
bbub05323  Rheumatoid arthritis
bbub05410  Hypertrophic cardiomyopathy
bbub05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102389416 (TGFB3)
   04350 TGF-beta signaling pathway
    102389416 (TGFB3)
   04390 Hippo signaling pathway
    102389416 (TGFB3)
   04068 FoxO signaling pathway
    102389416 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102389416 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102389416 (TGFB3)
   04218 Cellular senescence
    102389416 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102389416 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102389416 (TGFB3)
   05212 Pancreatic cancer
    102389416 (TGFB3)
   05225 Hepatocellular carcinoma
    102389416 (TGFB3)
   05226 Gastric cancer
    102389416 (TGFB3)
   05220 Chronic myeloid leukemia
    102389416 (TGFB3)
   05211 Renal cell carcinoma
    102389416 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102389416 (TGFB3)
   05321 Inflammatory bowel disease
    102389416 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102389416 (TGFB3)
   05414 Dilated cardiomyopathy
    102389416 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102389416 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102389416 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102389416 (TGFB3)
   05161 Hepatitis B
    102389416 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102389416 (TGFB3)
   05144 Malaria
    102389416 (TGFB3)
   05145 Toxoplasmosis
    102389416 (TGFB3)
   05140 Leishmaniasis
    102389416 (TGFB3)
   05142 Chagas disease
    102389416 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bbub04052]
    102389416 (TGFB3)
Cytokines and growth factors [BR:bbub04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102389416 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 102389416
NCBI-ProteinID: XP_006052922
LinkDB
Position
11
AA seq 452 aa
MHLLAKPQSSGSREAAWFSSLLLHDCRGLLLPGLAAFLPGPRLKMHLQRALVVLALLNFA
TVSLSMSTCTTLDFNHIKRKRVEAIRGQILSKLRLTSPPDPSGLASVPIQVLDLYNSTRE
LLEEVHGERGDVCTQANTESEYYAKEIYKFDMIQGLEEHNDLTVCPKGITSKIFRFNVSS
VEKNETNLFRAEFRVFRMPNPASKRSEQRIELFQILQPGEHIAKQRYIDGKNLPTRGTGE
WLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIQELMEIKFKGVDSDDD
PGRGDLGRLKKKKEHIPHLILMMIPPNRLDSPGHSQRKKRALDTNYCFRNLEENCCVRPL
YIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSSDTTHSTVLGLYNTLNPEASASPCCVP
QDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgcaccttcttgccaagcctcagtcttcgggatctagggaggccgcctggttttcctcc
ctccttctgcacgactgccggggtctcctcctgccaggccttgcggcctttctccccggc
ccccgcctgaagatgcacttgcagagggctctggtggtcctggccctgctgaactttgcc
acggtcagcctctccatgtccacttgcaccaccttggacttcaaccacatcaagaggaag
cgggtggaagccattaggggacagatcttgagcaaactcaggctcaccagtccccccgat
ccatccgggttggccagtgtccccatccaggtcctggatctttacaacagcacccgagag
ctactggaggaggtgcacggggagaggggagacgtctgcacgcaagcaaacaccgagtcg
gagtattatgccaaagaaatctataaattcgacatgatccaggggctggaggagcacaat
gacctgaccgtctgccccaaaggcatcacctccaagattttccgcttcaacgtgtcctca
gtggagaaaaacgaaaccaacctgttccgagcagaattccgggtctttcggatgcccaac
cctgcctccaagcgcagcgagcagaggattgagctcttccagattctccagccgggtgag
cacatagccaagcagcggtatatcgatggcaagaacctgcccacgcggggcactggcgag
tggctgtctttcgacgtcacagacactgtgcgtgaatggctcttgcggagagaatccaac
ttaggtctggaaatcagcatccactgtccctgtcacacctttcagcccaatggggatatc
ctggaaaacattcaagagctgatggaaatcaaattcaaaggtgtggacagtgatgatgat
ccgggccgcggagatctggggcgacttaagaagaagaaggaacacatccctcatctaatc
ctcatgatgattcccccaaaccggctagacagcccaggccacagtcagaggaagaagcgg
gccctggacaccaattactgcttccgcaatttggaggagaactgctgtgtgcgtcctctc
tacattgacttccgacaggatctgggctggaaatgggtccatgaacctaagggctactat
gccaacttctgctcaggcccatgcccgtacctccgcagctcagacacaacgcacagcacg
gtgctgggcctgtacaacaccctgaacccggaagcctcagcctccccttgctgcgtaccc
caggacttggagcccctgaccatcctgtactatgtcgggaggacccccaaagtggagcag
ctgtctaacatggtggtgaagtcctgcaagtgcagctga

KEGG   Bubalus bubalis (water buffalo): 102390629
Entry
102390629         CDS       T05912                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04010  MAPK signaling pathway
bbub04060  Cytokine-cytokine receptor interaction
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04218  Cellular senescence
bbub04350  TGF-beta signaling pathway
bbub04380  Osteoclast differentiation
bbub04390  Hippo signaling pathway
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub05140  Leishmaniasis
bbub05142  Chagas disease
bbub05144  Malaria
bbub05145  Toxoplasmosis
bbub05146  Amoebiasis
bbub05152  Tuberculosis
bbub05161  Hepatitis B
bbub05166  Human T-cell leukemia virus 1 infection
bbub05200  Pathways in cancer
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05220  Chronic myeloid leukemia
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05321  Inflammatory bowel disease
bbub05323  Rheumatoid arthritis
bbub05410  Hypertrophic cardiomyopathy
bbub05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102390629 (TGFB2)
   04350 TGF-beta signaling pathway
    102390629 (TGFB2)
   04390 Hippo signaling pathway
    102390629 (TGFB2)
   04068 FoxO signaling pathway
    102390629 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102390629 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102390629 (TGFB2)
   04218 Cellular senescence
    102390629 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102390629 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102390629 (TGFB2)
   05206 MicroRNAs in cancer
    102390629 (TGFB2)
   05205 Proteoglycans in cancer
    102390629 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102390629 (TGFB2)
   05212 Pancreatic cancer
    102390629 (TGFB2)
   05225 Hepatocellular carcinoma
    102390629 (TGFB2)
   05226 Gastric cancer
    102390629 (TGFB2)
   05220 Chronic myeloid leukemia
    102390629 (TGFB2)
   05211 Renal cell carcinoma
    102390629 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102390629 (TGFB2)
   05321 Inflammatory bowel disease
    102390629 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102390629 (TGFB2)
   05414 Dilated cardiomyopathy
    102390629 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102390629 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102390629 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102390629 (TGFB2)
   05161 Hepatitis B
    102390629 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102390629 (TGFB2)
   05144 Malaria
    102390629 (TGFB2)
   05145 Toxoplasmosis
    102390629 (TGFB2)
   05140 Leishmaniasis
    102390629 (TGFB2)
   05142 Chagas disease
    102390629 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bbub04052]
    102390629 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:bbub00536]
    102390629 (TGFB2)
Cytokines and growth factors [BR:bbub04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102390629 (TGFB2)
Glycosaminoglycan binding proteins [BR:bbub00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102390629 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 102390629
NCBI-ProteinID: XP_006076243
LinkDB
Position
5
AA seq 442 aa
MHYCVLSAFLLLHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSFLPSETVCPV
VTTPSGSVGSLCSRQSQVFCGYLDAIPPTFYRPYFRIVRFDVSSMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKSPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcgtttctgctcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacgctcgacatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagactaccccgaaccc
gaggaggtccccccggaggtgatctccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagcggagcgacgaggaatactacgcc
aaggaggtttacaaaatagacatgccgtccttcttaccctcggaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctccagacagtcccaggttttctgt
gggtaccttgatgccatcccgcccactttctacagaccgtactttagaattgtccgattt
gacgtctcctcgatggagaagaatgcttccaatttggtgaaggccgagttcagagtcttt
cgtttacagaacccaaaagccagagtgcctgaacaacggatcgagctgtatcagattctc
aaatccaaagatttaacatctccaacccagcgctacattgacagcaaagtcgtgaaaacc
agagcagagggcgaatggctctccttcgacgtcaccgatgctgttcacgaatggctccac
cataaagacaggaacctgggatttaaaataagtttacactgtccctgctgcacttttgta
ccatcgaataattacatcatccccaataaaagtgaagaactagaagcacgctttgcaggt
attgatggcacctctacctataccagtggtgatcagaaaacaataaagtccactaggaaa
aaaaacagtgggaagagcccacatctcctgctaatgttgttgccctcctacagacttgag
tcccaacagtccaaccggcggaagaagcgcgctctggatgcagcctattgctttagaaat
gtgcaggataattgttgcctacgcccactttacattgatttcaagagggatcttgggtgg
aaatggattcatgagcctaaagggtacaatgccaacttctgtgctggagcatgcccatat
ctgtggagctcagacactcagcacagtagggttctcagcttatataataccataaatcca
gaagcgtctgcttccccttgctgcgtgtcccaagatttagagccgctcaccattctctac
tacattggcaaaacacccaagatcgaacagctttctaatatgattgtcaagtcttgcaaa
tgcagctaa

KEGG   Bubalus bubalis (water buffalo): 102413660
Entry
102413660         CDS       T05912                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1 isoform X3
  KO
K13375  transforming growth factor beta-1
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04010  MAPK signaling pathway
bbub04060  Cytokine-cytokine receptor interaction
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04218  Cellular senescence
bbub04350  TGF-beta signaling pathway
bbub04380  Osteoclast differentiation
bbub04390  Hippo signaling pathway
bbub04659  Th17 cell differentiation
bbub04672  Intestinal immune network for IgA production
bbub04926  Relaxin signaling pathway
bbub04932  Non-alcoholic fatty liver disease
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub05140  Leishmaniasis
bbub05142  Chagas disease
bbub05144  Malaria
bbub05145  Toxoplasmosis
bbub05146  Amoebiasis
bbub05152  Tuberculosis
bbub05161  Hepatitis B
bbub05166  Human T-cell leukemia virus 1 infection
bbub05200  Pathways in cancer
bbub05205  Proteoglycans in cancer
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05220  Chronic myeloid leukemia
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05321  Inflammatory bowel disease
bbub05323  Rheumatoid arthritis
bbub05410  Hypertrophic cardiomyopathy
bbub05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102413660 (TGFB1)
   04350 TGF-beta signaling pathway
    102413660 (TGFB1)
   04390 Hippo signaling pathway
    102413660 (TGFB1)
   04068 FoxO signaling pathway
    102413660 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102413660 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102413660 (TGFB1)
   04218 Cellular senescence
    102413660 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102413660 (TGFB1)
   04672 Intestinal immune network for IgA production
    102413660 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102413660 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102413660 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102413660 (TGFB1)
   05205 Proteoglycans in cancer
    102413660 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102413660 (TGFB1)
   05212 Pancreatic cancer
    102413660 (TGFB1)
   05225 Hepatocellular carcinoma
    102413660 (TGFB1)
   05226 Gastric cancer
    102413660 (TGFB1)
   05220 Chronic myeloid leukemia
    102413660 (TGFB1)
   05211 Renal cell carcinoma
    102413660 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102413660 (TGFB1)
   05321 Inflammatory bowel disease
    102413660 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102413660 (TGFB1)
   05414 Dilated cardiomyopathy
    102413660 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102413660 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102413660 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102413660 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102413660 (TGFB1)
   05161 Hepatitis B
    102413660 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102413660 (TGFB1)
   05144 Malaria
    102413660 (TGFB1)
   05145 Toxoplasmosis
    102413660 (TGFB1)
   05140 Leishmaniasis
    102413660 (TGFB1)
   05142 Chagas disease
    102413660 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bbub03110]
    102413660 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bbub04052]
    102413660 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:bbub00536]
    102413660 (TGFB1)
Chaperones and folding catalysts [BR:bbub03110]
 Intramolecular chaperones
  Others
   102413660 (TGFB1)
Cytokines and growth factors [BR:bbub04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102413660 (TGFB1)
Glycosaminoglycan binding proteins [BR:bbub00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102413660 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 102413660
NCBI-ProteinID: XP_006052124
LinkDB
Position
18
AA seq 391 aa
MPPSGLRLLPLLLPLLWLLMLTPGRPVAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGDVPPGPLPEAILALYNSTRDRVAGESAETEPEPEADYYAKEVTRVLMVEYGNKI
YDKMKSSSHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLTRREEIEGFRLSAHCSCDSKDNTLQVDINAGF
SSGRRGDLATIHGMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLY
IDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQ
ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgccgccctcggggctgcggctgctgccgctgctgctgccgctgctgtggctactaatg
ctgacgcctggccggccggtcgccggactgtccacctgcaagaccatcgacatggagcta
gtgaagcggaagcgcatcgaggccatccgcggccagattttgtccaagcttcggctcgcc
agccccccgagccagggggatgtgccacccggcccgctgcccgaggccatactggccctt
tacaacagtacccgcgaccgggtggccggggaaagtgccgaaacggagcctgagccagag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaatacggcaacaaaatc
tatgacaaaatgaagtctagctcgcacagcatatatatgttcttcaacacgtctgagctc
cgggaagcggtgcccgaacctgtgttgctctctcgggcagagctgcgcctgctgaggctc
aagttaaaagtggagcagcacgtggagctgtaccagaaatatagcaacaattcctggcgc
tacctcagcaaccggctgctcgcccccagcgactcaccggagtggctgtcctttgacgtc
actggagttgtgcggcagtggctgacccgcagagaggaaatagagggctttcgcctcagt
gcccactgttcctgtgacagtaaagataacactcttcaagtggacattaacgcagggttc
agttccggccgccggggtgacctcgccaccattcacggcatgaaccggcccttcctgctc
ctcatggccacccctctggagagggcccagcacctgcacagctcccgccaccgccgagcc
ctggacaccaactactgcttcagctccacagaaaagaactgctgtgttcgtcagctctac
attgacttccggaaggacctgggctggaagtggattcacgaacccaaggggtaccacgcc
aatttctgcctggggccctgcccttacatctggagcctggacacacagtacagcaaggtc
ctggccctgtacaaccagcacaacccgggcgcgtcggcggcgccgtgctgcgtgcctcag
gcgctggagcccctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagttg
tccaacatgatcgtgcgctcctgcaagtgcagctga

DBGET integrated database retrieval system