KEGG   Bubalus bubalis (water buffalo): 102389753Help
Entry
102389753         CDS       T05912                                 

Gene name
UCP1
Definition
(RefSeq) mitochondrial brown fat uncoupling protein 1
  KO
K08769  solute carrier family 25 (mitochondrial uncoupling protein), member 7
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub03320  PPAR signaling pathway
bbub04371  Apelin signaling pathway
bbub04714  Thermogenesis
bbub05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102389753 (UCP1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102389753 (UCP1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102389753 (UCP1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    102389753 (UCP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbub02000]
    102389753 (UCP1)
Transporters [BR:bbub02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   102389753 (UCP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 102389753
NCBI-ProteinID: XP_006079309
LinkDB All DBs
Position
17
AA seq 305 aa AA seqDB search
MVGHTASDVPPTMAVKIFSAGVAACVADIITFPLDTAKVRLQIQGECLTSSAIRYKGVLG
TIITLAKTEGPVKLYSGLPAGLQRQISFASLRIGLYDTVQEFFTTGKEASLGSKISAGLT
TGGVAVFIGQPTEVVKVRLQAQSHLHGPKPRYTGTYNAYRMIATTEGLMGLWKGTTPNLT
RNVIINCTELVTYDLLKKALVKNKLLADDVPCHFVSAVVAGFCTTVLSSPVDVVKTRFVN
SSPGQYTSVPNCAMMMFIREGPSAFFKGFVPSFLRLGSWNIIMFVCFEQLKRELMKSRQT
MDCAT
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggtgggacacacagcgtcagacgtgccccctaccatggcggtcaagatcttctcggct
ggggtggcggcctgcgtggctgacataatcaccttcccgctggacaccgccaaagtccgg
ctacagatccagggcgaatgcctgacctccagtgccattaggtataaaggcgtcctggga
acaatcatcactctggcaaaaacagaagggccagtgaaactctacagcgggctgcctgct
ggtctccagagacaaataagcttcgcctctcttaggatcggcctctatgatactgtccag
gagttcttcaccacagggaaagaagctagtttaggaagcaagatctcagcgggtctaacg
actggaggcgtggccgtgttcattgggcaacccacagaggtggtcaaggtcagactgcaa
gctcagagccatctccacggtcccaaacctcgatacactgggacttacaatgcttacaga
atgatagcaacaacagaaggcttgatggggctttggaaagggactactcccaatctgaca
agaaatgtcatcatcaactgtacagagctagtaacgtatgacctactgaagaaggccctt
gtgaaaaacaaactattagcagacgacgtgccctgccacttcgtgtccgctgttgttgct
ggattctgcacaacggttctgtcctctcccgtggatgtggtgaaaacccgatttgttaac
tcttcaccaggacagtacacaagtgtgcccaactgcgcaatgatgatgttcattagggaa
ggaccgtcagcttttttcaaaggatttgtaccttccttcttgcgactgggatcctggaac
atcatcatgtttgtgtgcttcgagcagctgaagcgagaattgatgaagtcgaggcagacc
atggactgtgcgacctag

DBGET integrated database retrieval system