KEGG   Bubalus bubalis (water buffalo): 102389841Help
Entry
102389841         CDS       T05912                                 

Gene name
ACSBG1
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase ACSBG1 isoform X1
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00061  Fatty acid biosynthesis
bbub00071  Fatty acid degradation
bbub01100  Metabolic pathways
bbub01212  Fatty acid metabolism
bbub03320  PPAR signaling pathway
bbub04920  Adipocytokine signaling pathway
Module
bbub_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    102389841 (ACSBG1)
   00071 Fatty acid degradation
    102389841 (ACSBG1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102389841 (ACSBG1)
   03320 PPAR signaling pathway
    102389841 (ACSBG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bbub01004]
    102389841 (ACSBG1)
Enzymes [BR:bbub01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     102389841 (ACSBG1)
Lipid biosynthesis proteins [BR:bbub01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   102389841 (ACSBG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 102389841
NCBI-ProteinID: XP_006073353
LinkDB All DBs
Position
20
AA seq 740 aa AA seqDB search
MPDSRAAPQESLLDASLGTTQENVGTRFLNRLPPGGPECVRKLSLNLRYQQEVRANVKSS
SLTDGQTLSKEPLSHALKLSTPEKVKDAQLNPPEEALWTTRADGRVRLRIDPICSQTPRT
VHQMFSTTLDKYGDLSAMGFKRQGTWEHISYTQYYLLARKAAKGFLKLGLERAHSVAILA
FNSPEWFFSAVGAVFAGGIITGIYTTSSPEACQYIAYDCRANIIVVDTQKQLEKILKIWK
HLPHLKAVVIYREAPPMRMPSVYTMEELMELGNEVPEEALDVIVNAQKPNQCCALVYTSG
TTGNPKGVMLSQDNITWTARYGSQAGDIQPAEIQQEVVVSYLPLSHIAAQIYDLWTGIQW
GAQVCFAEPDALKGSLVNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWA
MSVTLEQNLTCPSSDLKPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMTAETQHFFL
GLNIRLYAGYGLSETSGPHFMSSPYNYRLYSSGKVVPGCQVKLVNEDAEGIGEICLWGRT
IFMGYLNMEDKTCEAIDAEGWLHTGDTGRLDADGFLYITGRLKELIITAGGENVPPVPIE
EAVKTELPIISNAMLIGDQRKFLSMLLTLKCTLDPDTFEPTDNLTEQAVEFCQRVGSKAT
TVSEVVGKKDEAVYQAIEEGIQRVNMNAAARPYHIQKWAILEKDFSISGGELGPTMKLKR
LAVLEKYKDVIDSFYQEQKK
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgccagacagcagagcagccccgcaggagagcctgctggatgcaagcctggggaccacc
caagaaaacgtgggaaccaggttcttaaacagactaccgccaggtgggcctgagtgtgtt
cgcaaactcagtttgaacctgcggtaccagcaagaagtaagagcgaatgtgaaaagcagc
tccctgactgatgggcagacgctctccaaagagcctctaagccatgctctcaaactctcg
accccagagaaggtgaaagatgcccagttgaatcctccagaagaggcgctatggacgact
cgggccgacgggcgcgtccgcctacgcatagaccccatctgctcgcagactccccgcact
gttcatcagatgttctccacgactctggacaagtatggggacctcagtgctatgggcttc
aagaggcagggcacgtgggaacacatctcctacacccagtactacctgctggcccgcaaa
gccgccaagggcttcctgaagctcggcctggagcgggcccacagcgtggccatccttgcc
ttcaactccccggagtggttcttctcagcggtgggcgcagtcttcgcaggtggcatcatc
accggcatctacacgaccagctcccctgaggcctgccagtatatcgcctatgactgccgc
gccaacatcatcgtggtcgacacacagaagcagctggaaaagatcctgaagatctggaaa
cacctaccacatctgaaggcagtagtgatatatagagaagcgcctcccatgcggatgccc
agcgtgtacacgatggaggagctcatggagctggggaatgaggtgcctgaggaggccctg
gatgtcatcgtcaacgcccagaagcctaaccagtgctgtgcattggtctacacgtcgggc
accaccgggaaccccaagggtgtgatgctgagtcaggacaatatcacatggacagcacgg
tacggcagccaggccggtgacatccaacctgcggaaatccaacaggaggtggtggtcagc
tacctgcctctcagccacattgccgcccagatctatgacctgtggacaggcatccagtgg
ggggcccaggtctgcttcgctgagcctgatgctctgaaggggagtctggtgaacacgctg
cgggaggtggagcccacgtcccacatgggggtgcctcgggtgtgggagaagatcatggag
cggatccaggaggtggcggctcagtctggcttcatccggcgcaagatgctgctctgggcc
atgtcggtgaccttggagcagaacctcacctgcccgagcagcgatctgaagcccttcaca
acccgactggcagattacctggtgctagccaaggtccgccaggcgctaggctttgccaag
tgtcagaagaacttctacggggcagcccccatgactgcggagacacagcacttcttcctg
ggcctcaacatccgcttgtatgcaggctacggcctcagcgagacctcaggcccccacttc
atgtccagcccctacaactaccgactctacagttccggcaaggtggtgccaggctgccag
gtgaagctggtgaatgaggacgcagagggcatcggggagatctgcctgtggggccgcacc
atcttcatgggctacctgaacatggaggacaagacgtgtgaggccatcgatgctgagggc
tggctgcacacgggagacacgggccgcctggatgccgacggcttcctctatatcacgggg
cgtctcaaagagttaatcatcacggctggtggggagaacgtgccccctgtgcccattgag
gaggccgtgaagacggagctgccaatcatcagcaatgccatgctgattggagaccagagg
aagttcctgtccatgctgctcaccttgaagtgtactctggaccctgacacctttgagccc
acggataatctgacggaacaagctgtggagttctgccagagggtgggcagcaaagccacc
acggtatctgaggttgtggggaagaaggatgaggccgtgtatcaggccatcgaagaaggg
atccagcgagtcaacatgaatgcagctgcacgaccctaccacatccagaagtgggccatt
cttgagaaggacttctccatttcaggtggagagttgggtcccacaatgaaactgaaacgg
ctcgcagtcctggagaagtacaaagatgtcatcgattccttttaccaagagcaaaaaaag
taa

KEGG   Bubalus bubalis (water buffalo): 102389907Help
Entry
102389907         CDS       T05912                                 

Gene name
ACSL5
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 5 isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00061  Fatty acid biosynthesis
bbub00071  Fatty acid degradation
bbub01100  Metabolic pathways
bbub01212  Fatty acid metabolism
bbub03320  PPAR signaling pathway
bbub04146  Peroxisome
bbub04216  Ferroptosis
bbub04714  Thermogenesis
bbub04920  Adipocytokine signaling pathway
Module
bbub_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    102389907 (ACSL5)
   00071 Fatty acid degradation
    102389907 (ACSL5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102389907 (ACSL5)
  09143 Cell growth and death
   04216 Ferroptosis
    102389907 (ACSL5)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102389907 (ACSL5)
   03320 PPAR signaling pathway
    102389907 (ACSL5)
  09159 Environmental adaptation
   04714 Thermogenesis
    102389907 (ACSL5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bbub01004]
    102389907 (ACSL5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102389907 (ACSL5)
Enzymes [BR:bbub01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     102389907 (ACSL5)
Lipid biosynthesis proteins [BR:bbub01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   102389907 (ACSL5)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   102389907 (ACSL5)
  Exosomal proteins of breast cancer cells
   102389907 (ACSL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C DUF501
Motif
Other DBs
NCBI-GeneID: 102389907
NCBI-ProteinID: XP_006044008
LinkDB All DBs
Position
23
AA seq 719 aa AA seqDB search
MCQDSQALRARRLHSLGAPRDVVPSQGLNFLLLFIKMLFIFNFLFSPLPTPALICILTFG
AAIFLWLVNRPQPALPHVDLNKQSVGIEGGARRSICQKDNDLIQYYFSDAKTTYEIFQRG
LAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKPSQDSFVGIFAQNRPE
WVISEFACYTYSMVAVPLYDTLGAEAVIYIINKADIATVICDTPQKALVLISNVEKGLTP
GLKLVILMDPFEDDLKKRGEKCGVEILSLFDAENLGKENFRKPVPPAPEDLSIICFTSGT
TGYPKGAMLTHANIVSNASGFLKSMEGVFEPNPEDVTISYLPLAHMFERVVQVIVYSYGA
KVGFFQGDIRLLPDDMRTLKPTLFPTVPRLLNKVYDKVQNEAKTPLKKFLLNLAVASKFR
EVKKGIIRRDSLWDKLIFGKIQESLGGKVRFLITGAAPISPPVLTFLRAAMGCLVFEAYG
QTECTAGCTITLPGDWKSGHVGVPMPCNHVKLEDVPDMNYFAVNNEGEICIRGPNLFKGY
LKDPEKTQETLDKDGWLHTGDIGRWLPNGTLKVIDRKKNIFKLAQGEYIAPEKIETVYIR
SSLVSQIFVHGESLQSFLVGVVVPDPDALPPFAAKIGVKGSIEELCQNQTIKKAILEDMH
KIGIEGGLKSFEQVKCIHLHPEPFSIENGLLTPTLKAKRGDLAKHFGTQIKSLYENTQE
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtgccaggactcacaggcactcagagccaggaggctccactcgctgggagcaccaaga
gatgtggtcccctcacagggcctgaatttcctgctgctattcataaagatgctttttatc
tttaacttcttattttccccacttccaaccccggcactgatctgcatcctgaccttcgga
gctgccatcttcctgtggttggttaacagacctcagcccgccttgcctcatgttgatctg
aacaagcagtcggtgggaattgagggaggagcacggagaagtatttgccagaaggacaat
gacctaatacaatactacttctcagatgccaagacgacatatgaaatcttccaaagagga
cttgctgtgtctgacaatgggccttgcttgggatatagaaaaccaaaccagccctacaga
tggctgtcctacaaacaggtgtctgatcgagcagagtacctgggctcctgtctcttgcat
aaaggatataaaccatcacaagacagctttgttggcatctttgctcagaataggccagag
tgggtcatctctgagttcgcttgttacacgtactccatggtagctgtgcccctgtatgat
accttgggagcagaggctgtcatatacatcatcaacaaggctgatatcgccacagtaatc
tgtgatacaccccaaaaggcattagtcctgatcagtaatgtggaaaagggcctcacccca
ggcctgaaattggtcatcctcatggatccctttgaggatgacctgaagaagagaggggag
aaatgtggagttgaaatcttatccttgtttgatgctgagaatttaggcaaagagaacttc
agaaaacccgtgcctcctgcaccagaagatctgagcatcatttgctttaccagtgggacc
acaggttatcccaaaggagccatgttaacccatgcaaatattgtttccaatgcttctggt
tttctcaaatctatggagggtgtttttgagcccaatcctgaggacgtgactatatcctac
ctccccttggctcatatgtttgaaagggttgtacaggtcatcgtgtactcttatggagcc
aaagtcggattcttccaaggagacatccggctgctgcctgatgacatgaggaccctgaag
cccacattgttccccacagtgcctcgactccttaacaaggtctatgataaggtacaaaat
gaagccaagacacccttgaagaagttcttgttgaacttggctgttgccagtaaattccgt
gaagtgaaaaagggtatcatcagacgtgacagtctgtgggacaagctcatctttggaaag
atccaggaaagcctgggtgggaaggttcggttcctgatcaccggagctgcccccatctca
cctcccgtcttgacgttcctccgggcagcaatgggatgtctggtgtttgaagcttatggt
caaacagaatgcactgctggctgtacaattacattacctggggactggaaatcaggtcac
gttggagtccccatgccttgcaatcatgtgaagctggaagatgtacctgatatgaactac
tttgccgtgaacaatgaaggagagatctgcatcaggggccccaatttgttcaaaggatac
ctgaaggaccccgagaagacacaggaaaccttggacaaggatggctggcttcacacagga
gacattggtcgctggctcccgaacggaactctgaaggtcatcgaccgaaaaaagaacatt
ttcaagctggcccaaggagaatacattgctccagagaagatagaaactgtctacatcagg
agtagtctggtgtcgcagatttttgtacatggggaaagcttacagtcattcctagtggga
gtggtggttcctgacccagatgcacttcccccatttgcagccaagattggggtaaagggc
tctattgaagaactgtgtcaaaaccaaactataaagaaagccatattagaagacatgcat
aaaattgggatagaaggtggccttaaatcctttgaacaggtcaaatgcatccatctacat
ccagagccattttccatcgaaaatggactcttgacaccaaccttgaaagcaaagcgggga
gaccttgccaagcactttggaactcaaatcaagagtctgtatgagaacacccaggagtag

KEGG   Bubalus bubalis (water buffalo): 102400078Help
Entry
102400078         CDS       T05912                                 

Gene name
ACSL6
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 6 isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00061  Fatty acid biosynthesis
bbub00071  Fatty acid degradation
bbub01100  Metabolic pathways
bbub01212  Fatty acid metabolism
bbub03320  PPAR signaling pathway
bbub04146  Peroxisome
bbub04216  Ferroptosis
bbub04714  Thermogenesis
bbub04920  Adipocytokine signaling pathway
Module
bbub_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    102400078 (ACSL6)
   00071 Fatty acid degradation
    102400078 (ACSL6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102400078 (ACSL6)
  09143 Cell growth and death
   04216 Ferroptosis
    102400078 (ACSL6)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102400078 (ACSL6)
   03320 PPAR signaling pathway
    102400078 (ACSL6)
  09159 Environmental adaptation
   04714 Thermogenesis
    102400078 (ACSL6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bbub01004]
    102400078 (ACSL6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102400078 (ACSL6)
Enzymes [BR:bbub01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     102400078 (ACSL6)
Lipid biosynthesis proteins [BR:bbub01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   102400078 (ACSL6)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   102400078 (ACSL6)
  Exosomal proteins of breast cancer cells
   102400078 (ACSL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 102400078
NCBI-ProteinID: XP_025148849
LinkDB All DBs
Position
9
AA seq 722 aa AA seqDB search
MLTFFLVSGGSLWLFSEFFLSLLEKMQTQEILRMLRLPELADLGQFFRSLSATTLVSMGA
LAAILAYWFTHRPKALKPPCNLLMQSEEVKDSGGARRSVIGDSPELFTHYYDDARTMYEV
FRRGLRISGNGPCLGFRNPKQPYQWLSYQEVADRAEFLGSGLLQHNCKPCTDQFIGVFAQ
NRPEWIIAELACYTYSMVVVPLYDTLGPGAVRYIINTADISTVIVDKPQKAVVLLEHVER
KETPGLKLIILMEPFEEALKDRGQECGVVIKSMQNVEDCGQQNHCDPVPPKPSDLSIVCF
TSGTTGNPKGAMLTHGNVVADFSGFLKVTESQWAPTCADVHISYLPLAHMFERMVQSVVY
CHGGRVGFFQGDIRLLSDDMKALCPTIFPVVPRLLNRMYNKIFSQADTPLKRWLLEFAAK
RKQAEVRSGIIRNDSIWDELFFHKIQASLGGCVRMIVTGAAPASPTVLGFLRAALGCQVY
EGYGQTECTAGCTFTTPGDWTSGHVGAPLPCNHIKLVDVEELNYWTSKGEGEICVRGPNV
FKGYLKDPERTKEALDDDGWLHTGDIGKWLPTGTLKIIDRKKHIFKLAQGEYVAPEMIEN
IYIQSEPVAQVYVHGDSLKAFLVGIVVPDAEVMPSWAQKRGIEGTYAELCANKELKKAIL
EDMVRLGQESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYST
SM
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccttcttcctcgtgtcggggggctccctctggctgttctcggagttcttcctc
tcgcttctggagaagatgcagactcaggagatcctgaggatgctgcggctgcccgagctg
gccgacttgggccagtttttccgcagcctctcggccaccaccctcgtgagtatgggtgcg
ctagccgccatccttgcctactggttcactcaccgaccgaaggccttaaagccaccgtgc
aatctcctgatgcagtcagaggaggtgaaggacagtggtggggcccggcgatccgtaata
ggggacagcccggagctgttcacccactactatgacgatgccaggaccatgtacgaggtg
ttccgccgtgggcttaggatctcagggaatggaccctgtcttggcttcaggaatcccaag
cagccttatcagtggctgtcctaccaggaggtggccgacagggctgaatttctagggtct
ggacttctgcagcacaattgtaaaccatgtacagatcagtttatcggcgtttttgcgcaa
aatcgaccagagtggatcatcgcagagcttgcctgttacacatactcaatggtggtggtc
cctctatatgataccctgggccctggggcagtccgctacatcatcaacacagctgacatc
agcaccgtgatcgtggataaacctcagaaagctgtggttctcctggagcacgtggagagg
aaggagacgccagggctcaagctgatcatcctcatggagccattcgaggaggccctgaaa
gacagagggcaggagtgcggggtggtcattaagtccatgcagaatgtggaggactgtggc
cagcagaatcactgtgatcctgtgcccccgaaacccagtgacctctccattgtgtgtttc
acgagcggcacgacagggaacccaaaaggtgcgatgctcacccatgggaacgtggtggct
gatttctcaggctttctgaaagtgacagagagtcagtgggctcccacttgtgcggatgta
cacatttcctatttgcctttagcacacatgtttgagcgaatggtacagtccgtcgtctac
tgccacggagggcgcgtgggcttcttccagggagacatccgcctcctctcagatgacatg
aaggccctgtgccccaccatcttcccagtggtcccccggctgctgaaccgcatgtacaac
aagatcttcagccaggcagacaccccattaaagcgctggctcctggaatttgcagcaaag
cgtaagcaggccgaggtccggagtggaatcatcaggaatgatagtatctgggatgaactc
ttctttcataagattcaggccagtctcggtgggtgcgtgaggatgattgttactggagca
gcccccgcatcaccaacagtcctgggatttctccgtgcagctctgggctgccaggtttat
gaaggttatggccaaacggagtgcacggcaggatgtaccttcaccacacctggggactgg
acctcaggacacgtaggggcacctctgccctgcaatcatatcaagctcgtcgatgttgag
gaactgaactactggaccagcaaaggagaaggagagatatgtgtgagaggaccaaatgtg
ttcaaaggttacttgaaagacccagagaggacaaaggaagccctggatgatgacggctgg
cttcacactggagacatcgggaaatggctgccgactggtactcttaaaattattgatcgg
aagaagcatatatttaaacttgctcagggagaatatgttgcgcccgagatgattgagaac
atctacatccagagcgagcctgttgcccaagtctatgtccacggggacagcttaaaggcc
tttttggtgggcattgtcgtgcctgatgcagaagtcatgccctcttgggcccagaagaga
ggaattgaagggacgtatgcagagctctgcgcaaataaggagctgaagaaagccatttta
gaagatatggtgaggttaggacaagaaagtggactccactcttttgaacaggttaaagcc
attcacatccactctgatatgttctcagttcaaaatggcttgctgacaccgaccctaaag
gctaagagacctgagctgagagagtacttcaaaaaacaaatagaagagctttactcaacc
tccatgtga

KEGG   Bubalus bubalis (water buffalo): 102402977Help
Entry
102402977         CDS       T05912                                 

Gene name
ACSL4
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 4 isoform X3
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00061  Fatty acid biosynthesis
bbub00071  Fatty acid degradation
bbub01100  Metabolic pathways
bbub01212  Fatty acid metabolism
bbub03320  PPAR signaling pathway
bbub04146  Peroxisome
bbub04216  Ferroptosis
bbub04714  Thermogenesis
bbub04920  Adipocytokine signaling pathway
Module
bbub_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    102402977 (ACSL4)
   00071 Fatty acid degradation
    102402977 (ACSL4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102402977 (ACSL4)
  09143 Cell growth and death
   04216 Ferroptosis
    102402977 (ACSL4)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102402977 (ACSL4)
   03320 PPAR signaling pathway
    102402977 (ACSL4)
  09159 Environmental adaptation
   04714 Thermogenesis
    102402977 (ACSL4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bbub01004]
    102402977 (ACSL4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102402977 (ACSL4)
Enzymes [BR:bbub01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     102402977 (ACSL4)
Lipid biosynthesis proteins [BR:bbub01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   102402977 (ACSL4)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   102402977 (ACSL4)
  Exosomal proteins of breast cancer cells
   102402977 (ACSL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 102402977
NCBI-ProteinID: XP_006071648
LinkDB All DBs
Position
X
AA seq 670 aa AA seqDB search
MAKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGKKETLGTREV
LSEENEMQPNGKVFKKLILGNYKWLNYLDVNRRVNNFGSGLTALGLKPKSTIAIFCETRA
EWMIAAQTCFKYNFPLVTLYATLGREAVVHGLNESEATYLITSVELLESKLKTALIDINC
VKHIIYVDNKAINKAEYPEGFEIHSMQSVEELGSKPENLSVSPNRPTPSDLAIVMYTSGS
TGRPKGVMMHHSNLIAGMTGQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIG
YSSPLTLSDQSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFK
IGYDYKLEQIKKGYDAPLCNLILFKKVKALLGGNVRMMLSGGAPLSPQTQRFMNVCFCCP
VGQGYGLTETCGAGTVTEVTDYTTGRVGAPLICCEIKLKDWQEGGYTIHDKPNPRGEIVI
GGKNISMGYFKNEEKTAEDYSVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGE
YVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQQKLTLLAQQKGVEGTWVDICN
NPAMEAEILKEIREAANTMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYL
KDIERMYGGK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagaataaaagctaagcccacctcagacaaacctggaagtccatatcgttct
gtcacgcacttcgactcgctagctgtcatagacatccctggagcagacaccctggataaa
ttattcgatcatgctgtctccaagtttgggaagaaggagaccctggggaccagggaagtc
ctaagtgaagaaaatgaaatgcagccaaatggaaaggtttttaagaagttaattctcggg
aattataaatggttgaactatctcgacgtgaaccgccgagtgaataacttcggtagtgga
ctcactgcactgggactgaagccaaagagcaccattgccattttctgtgagaccagggct
gaatggatgattgcggcacagacctgctttaagtacaattttcctcttgtgactttatat
gccacccttggcagagaagctgtagttcatgggttaaatgaatctgaggctacatatctg
attactagtgttgaacttctggagagtaaacttaagactgcattgatagatatcaactgt
gttaaacatatcatttatgtggacaataaggctatcaataaagcagaataccctgaagga
tttgagattcacagcatgcaatcagtagaagagttgggatccaagccagaaaacttgagc
gtttctccaaatagaccaactccttcagacttggctattgtcatgtataccagtggatct
actggccgacctaagggagtgatgatgcatcatagcaatttgatagctggaatgactggc
cagtgtgagagaattcctgggctgggaccaaaggatacgtatattggctacctgcctttg
gctcatgtgcttgagttgacagcagagatctcttgctttacctatggctgtaggattgga
tattcttctccacttacactctctgaccagtccagcaaaattaaaaagggaagcaaggga
gactgtactgtactgaagcctacactcatggctgctgtcccggaaatcatggatagaatt
tataagaatgttatgagcaaagtccaagagatgaattatattcagaaaactctgttcaag
atagggtatgattacaaattggaacagattaaaaagggatatgatgcaccactttgcaat
ctgatactgtttaaaaaagtgaaggctctgctgggagggaatgtccgtatgatgctgtct
ggtggagcacccctgtctccgcagacacagcgattcatgaatgtctgcttctgctgccca
gttggtcagggttatggattaacagaaacgtgtggtgctgggacagttactgaagttact
gactataccactggcagagttggggcccctcttatttgctgtgaaattaagctaaaagac
tggcaggaaggcggctatacaattcatgacaagccaaaccccagaggtgaaatcgtaatt
ggtggaaagaatatctccatgggatattttaaaaatgaggagaaaacggctgaggattat
tctgtggatgaaaatggccaaaggtggttttgcactggtgatattggagaattccatccc
gatgggtgtttacagattatcgaccgtaagaaagatctggtgaagttacaagcaggagaa
tatgtgtctctcgggaaagtagaagctgcactgaagaactgtccacttattgataacatc
tgtgcttttgccaaaagtgaccagtcctatgtgataagttttgtggttcctaatcagcaa
aagttgacacttttggcacaacagaaaggggtagaaggaacttgggttgatatctgcaat
aaccctgccatggaagctgaaatactgaaagagattagagaagctgcaaataccatgaaa
ctggagcgatttgaaattccaatcaaggttcgattaagcccagagccctggacccctgaa
actggtttggtcactgatgctttcaaactgaaaaggaaggaactgaagaaccattacctc
aaagacattgagcgaatgtatgggggcaaataa

KEGG   Bubalus bubalis (water buffalo): 102410401Help
Entry
102410401         CDS       T05912                                 

Gene name
ACSL3
Definition
(RefSeq) LOW QUALITY PROTEIN: long-chain-fatty-acid--CoA ligase 3
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00061  Fatty acid biosynthesis
bbub00071  Fatty acid degradation
bbub01100  Metabolic pathways
bbub01212  Fatty acid metabolism
bbub03320  PPAR signaling pathway
bbub04146  Peroxisome
bbub04216  Ferroptosis
bbub04714  Thermogenesis
bbub04920  Adipocytokine signaling pathway
Module
bbub_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    102410401 (ACSL3)
   00071 Fatty acid degradation
    102410401 (ACSL3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102410401 (ACSL3)
  09143 Cell growth and death
   04216 Ferroptosis
    102410401 (ACSL3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102410401 (ACSL3)
   03320 PPAR signaling pathway
    102410401 (ACSL3)
  09159 Environmental adaptation
   04714 Thermogenesis
    102410401 (ACSL3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bbub01004]
    102410401 (ACSL3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102410401 (ACSL3)
Enzymes [BR:bbub01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     102410401 (ACSL3)
Lipid biosynthesis proteins [BR:bbub01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   102410401 (ACSL3)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   102410401 (ACSL3)
  Exosomal proteins of breast cancer cells
   102410401 (ACSL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 102410401
NCBI-ProteinID: XP_006079706
LinkDB All DBs
Position
2
AA seq 720 aa AA seqDB search
MNNHGSSKPSSMKLKHTINPILLYFIQFIISLYTILTYIPYYFLSESRQEKSNRTKAKPV
NSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFMHAKNKFKDKRLLGTREILNEEDEVQPN
GKVFKKVILGSYNWLSYEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMVAAQACF
MYNFQLVTLYATLGGPAIVHGLNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGK
PPTWSEFPKGVIVHTMAAVQALGAKASVENKPLSKPAPSDIAVIMYTSGSTGIPKGVMIS
HSNIIAGITGMAERIPELGEKDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQ
SSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVNEMSSFQRNLFILAYNYKMEQI
SKGHSTPLCDSFIFRKVRGLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTES
CGAGTITEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQNVTMGYY
KNEAKTKADFFEDENGQRWLCTGDIGEFDPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAA
LKNLPLIDNICAYANSYHSYVIGFVVPNQKELTELARRKGLHGTWEELCNSCEMENEVLK
VLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaataaccacgggtcttcaaaaccgtcttccatgaagctgaaacacaccatcaacccc
attcttttgtatttcatacagttcataatatcactttatactattttaacatacattcca
tattattttttgtctgagtcaagacaagaaaaatcaaaccgaactaaagcaaagcctgta
aattcaaaacctgactctgcatacagatctgttaacagcttggatggtttggcctccgta
ttataccctggatgtgatacacttgataaagtttttatgcatgcaaaaaacaaattcaag
gacaaaagactcttgggaacacgtgaaatactaaatgaggaagatgaagtgcaaccgaat
ggaaaagtttttaaaaaggttattcttggaagctataattggctttcctatgaagatgtc
tttgtgagagcctttaattttggaaacggcttacagatgctgggtcagaagcccaagacc
aacatcgccatcttctgtgagaccagggcagagtggatggtcgctgcacaggcctgcttc
atgtataattttcagcttgttacgctgtatgctactctagggggtccagcaattgttcat
ggattaaatgaaacagaggtgaccaacatcattactagtaaagaactcttgcagacaaag
ttgaaggacatcgtttctctggtccctcgcctgcggcacatcatcactgtagatggaaag
ccgccgacctggtctgagttccccaagggcgtcatcgtgcacaccatggcagccgtgcag
gctctgggagccaaggccagcgtggaaaacaaaccccttagcaaaccagcgccctcagat
attgcagtaatcatgtacacaagtggatccacaggaattccaaagggggtcatgatctct
catagtaacattattgctggtataactgggatggcggaaaggattccagaactcggggag
aaagatgtttacattggatatttgcctctggcccacgtcttagaattaagtgctgagctt
gtctgtctctcccatggatgccgcatcggctactcttcaccacagactttagcagatcag
tcttcaaaaataaaaaaaggaagtaaaggagatacatccatgttgaaaccaacactgatg
gcagctgtcccggaaatcatggatcgaatctacaaaaatgtcatgaataaagtgaatgaa
atgagcagttttcaacgcaatctgtttattctggcctataattacaaaatggaacagatt
tcaaaagggcacagtactccgctgtgtgatagctttattttccggaaagttcgaggcttg
ctaggtggaaatattcgacttctgttgtgtggaggtgctccactttctgcaaccacacag
cgattcatgaacatctgtttttgctgtcctgttggtcaggggtatggactcactgaatct
tgtggggctggaacaattacagaagtgtgggactacaataccggcagagtgggagcacca
ttagtttgctgtgaaatcaaattaaagaactgggaggaaggtggatactttaataccgat
aaaccgcatcccaggggtgagattcttattggtggccaaaatgtgacaatggggtactac
aaaaatgaagcgaaaacaaaagctgatttttttgaagatgaaaatggacagaggtggctc
tgtactggagacattggggagtttgaccctgatggttgtttgaagatcattgatcgtaag
aaggaccttgtaaaactacaggcaggagaatatgtttctcttgggaaggtggaggctgct
ttgaagaatctcccattaatagataacatttgtgcatatgcaaacagttatcattcttat
gtcatcggatttgttgtgccaaatcaaaaggaactaacagaactagcacgaaggaaagga
cttcatgggacttgggaggagctgtgtaacagctgtgaaatggagaatgaggtactgaaa
gtgctttctgaagctgctatttcagcaagtctggaaaagtttgaaattccagtaaaaatt
cgtttgagccctgaaccgtggacccctgaaactggtctggtgacagatgccttcaagctg
aaacgaaaagagcttaaaacacattaccaggcggacattgagcgaatgtatggaagaaaa
tag

KEGG   Bubalus bubalis (water buffalo): 102413850Help
Entry
102413850         CDS       T05912                                 

Gene name
ACSBG2
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase ACSBG2
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00061  Fatty acid biosynthesis
bbub00071  Fatty acid degradation
bbub01100  Metabolic pathways
bbub01212  Fatty acid metabolism
bbub03320  PPAR signaling pathway
bbub04920  Adipocytokine signaling pathway
Module
bbub_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    102413850 (ACSBG2)
   00071 Fatty acid degradation
    102413850 (ACSBG2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102413850 (ACSBG2)
   03320 PPAR signaling pathway
    102413850 (ACSBG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bbub01004]
    102413850 (ACSBG2)
Enzymes [BR:bbub01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     102413850 (ACSBG2)
Lipid biosynthesis proteins [BR:bbub01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   102413850 (ACSBG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding Cas_Cas2CT1978
Motif
Other DBs
NCBI-GeneID: 102413850
NCBI-ProteinID: XP_025149922
LinkDB All DBs
Position
9
AA seq 716 aa AA seqDB search
MTLQPMLCCDGQNHTCMVKNGLCRPRRPETQTTQEEKDEDLKVDMSQEQVTPRLWTIHRD
GEVLMRLSKHGPGHESPLTIPEFFRESVNRFGSYPALASKKNGRWEVLNYNQYYEACRKT
ARAMLKQTSPVSPFSACPSVSAFPAGLEPFHSVGILGFNSIEWILAALGAIFAGGFCVGI
YATNFADACEYVITHAKVNILLVENNAQLQKILSIPTNKMETLKAIVQYKPPVDDSKCEN
LYSWDDFLELGSSIPDAQLDQIIKSQKANQCAVIIYTSGTTGQPKGVMLSHDNITWTAGS
VAKECNLAYAPEKQEVVVSYLPLSHIAAQMMDVWVPIKVGAFIYFAEPDALKGTLVNTLQ
EVKPTAFLGVPRIWEKMHEKIKEAVGKSSSLRKKVFLWARNIGLKVNSKRMLGEHDHPMS
YRMARALVFTKIKNSLGLDHCRIFISGAAPLNQETSEFFLSLDIPIGEVYGMSESSGPHT
ISTPANYKLLSSGKVVAGCKNMLYQPSKDGVGEVCLWGRHVFMGYLEQEDATMEAIDEEG
WLHSGDLGRMDNQGFLFITGRIKEIIITAGGENVAPVPIENLVKETIPIISNAMLVGDKA
KFLSILLTLKCEVDKMTGEPLDTLNWEAIKFCREVGSHATTVSEILDLRDPMVYAAIQKG
INAVNQKAISNAQKIQKWVILEKDFTISGGELGPTTKIKRHFILQKYKRQIYSFYQ
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgactctgcaacccatgctttgctgtgatggccagaaccatacctgcatggtgaagaat
ggtctctgtagacccagaaggcctgaaacccagacaactcaagaagagaaggacgaggac
ctcaaagtagacatgagccaagaacaagttactcctaggctgtggaccattcaccgagat
ggagaagtccttatgaggctatcgaaacatgggccaggccatgagagccccttgaccatc
cctgaattttttcgggagtcggtcaaccgatttgggtcttatccagccctagcatcaaag
aagaatggaaggtgggaagttctgaactacaaccagtactatgaggcttgtcggaagact
gcgagagccatgctcaagcaaacctcgcctgtgtctccattttctgcttgtccgtctgtt
tctgccttcccagctgggctggagcctttccactcagttggcatccttgggtttaactcc
atcgagtggatccttgcagctcttggtgccatctttgcggggggcttctgtgttggtatt
tatgccaccaactttgccgacgcctgtgaatatgtcattactcatgccaaagtgaacatc
ctgctggtggaaaataatgcacagttgcagaaaatcctttcgattccgacgaacaagatg
gagaccctaaaagcgatcgttcagtacaagccgcccgtggacgacagcaaatgtgaaaac
ctgtactcttgggatgacttcctagaacttggcagtagcattcccgatgcccaactggac
cagatcataaaaagccagaaggccaatcagtgtgctgtgatcatctacacttcggggacc
acaggccaacccaagggggtgatgctcagccatgacaatatcacgtggacagcggggtcg
gtggcgaaggaatgcaacctggcttatgcccccgaaaagcaggaggtggtggtcagctac
cttcctctcagccacatcgcagctcagatgatggacgtctgggtgcccattaaggtcggg
gctttcatctactttgctgaaccagacgctctcaagggcaccttggtcaacaccttgcaa
gaggtaaagcctactgccttcctgggggtaccccgaatttgggaaaagatgcatgagaag
ataaaggaggctgttggcaagtcttcaagcttgaggaaaaaggtgtttctgtgggcaagg
aatattggcttaaaggtcaactcgaaaaggatgctaggggaacatgaccatcccatgagc
taccgcatggcaagggcactcgtgttcaccaaaatcaagaattcccttggcctggatcac
tgccgcatttttatcagcggggccgcacccctcaaccaggagacttctgagttcttttta
agcctggacataccaataggcgaggtgtacggtatgagtgaaagctcaggaccccacacc
atatccaccccagcaaactacaagttactaagttctggtaaagttgtggcagggtgtaag
aacatgctgtaccagccgagcaaggatggcgtgggggaagtctgcctctggggccggcat
gtcttcatgggctacctggagcaggaggacgcgaccatggaggccattgacgaggagggc
tggctccactctggggacctgggccgcatggacaaccagggcttcctctttatcaccggc
cgcatcaaagaaatcatcatcacagctggtggcgagaatgtggctcccgttcccatcgag
aacctggttaaggagacgatccccatcattagtaatgccatgttggtgggcgacaaggcc
aagttcctgagcatcctcctgacactgaagtgcgaggttgacaaaatgaccggagagcca
ctggacacgctgaactgggaggcgatcaagttctgccgggaggtgggcagccatgcgacc
acagtgtctgagatcctggacctgcgagaccccatggtctacgcggccatccagaaaggc
atcaatgctgtcaaccaaaaagccatctccaacgcacagaagattcagaagtgggtcatc
ttggagaaggactttaccatcagtggcggagagctaggtccaacgacaaagattaaacga
catttcatcctccagaaatacaaaaggcagatctacagcttctaccagtga

KEGG   Bubalus bubalis (water buffalo): 102414095Help
Entry
102414095         CDS       T05912                                 

Gene name
ACSL1
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 1 isoform X2
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00061  Fatty acid biosynthesis
bbub00071  Fatty acid degradation
bbub01100  Metabolic pathways
bbub01212  Fatty acid metabolism
bbub03320  PPAR signaling pathway
bbub04146  Peroxisome
bbub04216  Ferroptosis
bbub04714  Thermogenesis
bbub04920  Adipocytokine signaling pathway
Module
bbub_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    102414095 (ACSL1)
   00071 Fatty acid degradation
    102414095 (ACSL1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102414095 (ACSL1)
  09143 Cell growth and death
   04216 Ferroptosis
    102414095 (ACSL1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102414095 (ACSL1)
   03320 PPAR signaling pathway
    102414095 (ACSL1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102414095 (ACSL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bbub01004]
    102414095 (ACSL1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102414095 (ACSL1)
Enzymes [BR:bbub01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     102414095 (ACSL1)
Lipid biosynthesis proteins [BR:bbub01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   102414095 (ACSL1)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   102414095 (ACSL1)
  Exosomal proteins of breast cancer cells
   102414095 (ACSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 102414095
NCBI-ProteinID: XP_006075175
LinkDB All DBs
Position
1
AA seq 699 aa AA seqDB search
MMQAHELFQYFRLPELVDFRQYVRTLPTNTLMGFGAFAALTTFWYATRPRALKPPCDLAM
QSVEVPGSDGARRSTLLDSDEPLVYFYDDVRTLYEGFQRGIHVSNNGPCLGSRKPDQPYE
WLSYKQVEDMAECVGSALLHKGFKAAPDQFIGIFAQNRPEWVIIEQGCFTYSMVIVPLYD
TLGTEAITYIINKAELSLVFVDKPEKANLLLEGVENKLIPGLKTIVLMDSYGSDLLERGK
KCGVEIISMKAMEDLGRANRQKPKPPAPEDLAVICFTSGTTGNPKGAMITHRNVVSDFSA
FVKMTENTFIPTSDDTLISFLPLAHMFERVVECVMLCHGAKIGFFQGDIRLLMDDLKALQ
PTIFPVVPRLLNRMFDRIFGQANTTLKRWLLDFASKRKEAELRSGIIRNNSLWDKLIFHK
IQSSLGGKVRLMITGAAPVSATVLTFLRAALGCQFYEGYGQTECTAGCCLTVAGDWTAGH
VGPPMPCSIIKLVDVEEMNYLAAKGEGEVCVKGSNVFQGYLKDPVKTAEALDKDGWLHTG
DIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYQRSEPIAQVFVHGESLQAFLIA
IVVPDVETLGAWAQKRGIVGSFEELCRNKDVKKGILEDMVRLGKESGLKPFEQVKGIYLH
PELFSIDSGLLTPTMKAKRPELRNYFRSQIDELYSTIKV
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaagcccacgagctgttccagtactttcggctgccagagctggttgacttccgg
cagtacgtgcgcacccttccaaccaacacgctcatgggcttcggcgcgttcgccgcgctc
accactttctggtacgccacgcggccacgagccctgaagcctccatgcgacctggccatg
cagtcagtggaggtgccgggcagtgatggtgcccggagatccacactcctggacagtgac
gagcccctggtgtatttctacgatgacgtcagaacgttatacgaaggtttccagaggggc
atacacgtgtccaataatggcccttgtttaggctctcggaaaccagaccaaccctatgaa
tggctttcatacaaacaggttgaagacatggcagagtgtgtgggctcagcactgctccac
aagggcttcaaggcagctccagaccagttcatcggcatcttcgctcagaacagacctgag
tgggtgatcattgaacagggatgctttacttactcgatggtgatcgttcccctctacgac
acccttggaactgaagccatcacctacatcatcaataaagccgaactctctttggttttt
gtggacaagccagagaaggccaacctcctattagaaggtgtagaaaataaattaatacca
ggccttaaaactattgttctcatggactcctacggcagtgatctgctggaacgaggcaag
aagtgtggggtggagatcatcagcatgaaggccatggaggacttgggaagagccaacaga
cagaagcccaagcctccagcacctgaagatcttgcagtaatttgcttcaccagtggaact
acaggcaaccccaaaggagcaatgatcacgcatcgaaatgtagtgagcgatttttcagcg
tttgtgaaaatgacagagaacacattcattcctacctcagatgacactttgatctctttc
ttgcctctggcccatatgtttgagagagttgttgagtgtgtgatgctctgtcatggagct
aaaataggatttttccaaggagatatcaggctgcttatggatgatctcaaggcccttcaa
cccaccatcttccctgtggtccccagactgctgaaccggatgtttgaccgaattttcgga
caagcaaacaccacgctgaagcgatggctgttggactttgcctccaagaggaaagaggct
gaacttcgcagtggcatcattagaaacaacagcctctgggataaactgatcttccacaaa
atacagtcgagcctgggaggaaaagtgaggctgatgatcacaggagcagcgcccgtgtct
gccaccgtgctcaccttcctgagggctgcgctgggctgccagttctacgaaggctacgga
cagaccgagtgtactgctggctgctgcctgactgttgctggagactggactgcaggccat
gttggtcccccaatgccttgcagcattatcaagcttgttgatgtggaagaaatgaattac
ctggctgccaagggcgagggcgaggtatgtgtgaaagggtcaaatgtttttcaaggctac
ttgaaagacccagtgaaaacagcagaagctctggataaagacggctggttgcacacaggg
gacattggcaagtggttaccaaatggcaccttgaagatcatcgacaggaagaagcacata
tttaaactggcacagggggagtacatagctcccgagaagatcgaaaacatctaccagcgg
agtgaacctatcgctcaggtgtttgtccacggagagagcttgcaggcatttcttatagcg
atcgtggtaccggacgttgagacgctaggtgcctgggcccagaagagaggcattgtgggc
tcctttgaagaactgtgcagaaacaaggatgtcaaaaaaggtattctagaagacatggtg
aggctcgggaaggagtctggcctaaaaccatttgaacaggttaaaggcatctatctccac
cctgaactcttctctatcgacagtggccttctgaccccaaccatgaaggctaaaaggcca
gagcttcggaattatttcaggtcacagattgatgagctttactccaccatcaaagtctaa

DBGET integrated database retrieval system