KEGG   Bubalus bubalis (water buffalo): 102390030Help
Entry
102390030         CDS       T05912                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform isoform X1
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00071  Fatty acid degradation
bbub01212  Fatty acid metabolism
bbub03320  PPAR signaling pathway
bbub04152  AMPK signaling pathway
bbub04714  Thermogenesis
bbub04920  Adipocytokine signaling pathway
bbub04922  Glucagon signaling pathway
bbub04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102390030 (CPT1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102390030 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102390030 (CPT1B)
   04920 Adipocytokine signaling pathway
    102390030 (CPT1B)
   03320 PPAR signaling pathway
    102390030 (CPT1B)
  09159 Environmental adaptation
   04714 Thermogenesis
    102390030 (CPT1B)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102390030 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bbub03029]
    102390030 (CPT1B)
Enzymes [BR:bbub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102390030 (CPT1B)
Mitochondrial biogenesis [BR:bbub03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102390030 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 102390030
NCBI-ProteinID: XP_025138358
LinkDB All DBs
Position
4
AA seq 797 aa AA seqDB search
MAEAHQAVAFQFTVTPEGVDFQLSREVLKHIYLSGIRSWKKRLIRIKNGILRGVYPGSPT
SWLVVVMATAGSSYYNVDISMGLVYYIQRWLPEGRPYRTPYTRTLFSMAIFSTGVWMMGI
FFFRQTLKLLLSYHGWMFEMHGQTSHLTRVWAVCVRLLSGRQPMLYSFQTSLPKLPVPSV
PATVHRYLESVEHLLDDEQYYRMETLAKEFEEKTAPRLQKYLVLKSWWATNYVSDWWEEY
VYLRGRNPIVVNSNYYVMDLVLVKNTDVQAARLGNAVHAMITYRRKLDREEIKPVMALGL
VPMCSYQMERMFNTTRIPGKDTDVLQHLPDSRHVAVYHKGRFFKVWLYEGSRLLKPRDLE
MQFQRILDDPSPPQPGEERLAALTAGGRVEWAQARQAFFSSGKNKAALDAIERAAFFVAL
DEESHHYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNTEHAWADAPII
GHLWEFVLGTDSFHLGYTETGHCLGKPNPVLPPPQRLQWDIPEQPSGLLDMTPESCWRAL
PPADPSVSWQCQAVIESSYQVAKALADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQ
LAHFRDRGKFCLTYEASMTRMFREGRTETVRSCTRESTAFVQAMVQGRHLNEDLQRLFRK
AAEKHQNMYRLAMTGAGIDRHLFCLYVVSKYLGVESPFLAEVLSEPWRLSTSQIAQFQIR
MFDPNKYPKHLGAGGGFGPVADDGYGVSYMIAGENTIFFHVSSKFSSSETNAQRFGNQIR
QALLDIANLFQVPKADG
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcgcaccaggctgtggccttccagttcactgtgaccccagagggggtcgac
ttccagctcagtcgggaggtgctgaaacacatctacctgtccgggatcaggtcctggaag
aaacgcctgattcgcatcaagaatggcatcctcaggggcgtgtaccctggcagccccacc
agctggctggtcgtggttatggcaacagcgggttcctcctactacaacgtggacatttcc
atgggactggtctattatatccagagatggcttcctgaggggcgtccctaccggacccca
tacacccggacgcttttcagcatggccatcttctccacgggggtctggatgatgggcatc
ttcttctttcgccaaaccctgaaactgcttctttcctaccacggttggatgtttgagatg
cacggccagaccagccacttgaccagagtctgggctgtctgtgtccgccttctgtctggc
cgacagcccatgctctacagcttccagacgtctctgcccaagctgccggtgcccagcgtg
ccagccacagttcatcggtatctagaatccgtggaacacttgttggatgatgagcaatat
tatcgaatggagacgctggccaaggagttcgaggagaagactgcccccaggctgcagaag
tacctggtactcaagtcctggtgggcaaccaactatgtgagcgactggtgggaggagtac
gtctacctccggggcaggaaccccatcgtggtcaacagcaactactacgtcatggacctg
gtgctcgtcaagaacacggacgtgcaggctgcccgcctgggaaatgctgtccacgccatg
atcacgtatcgccgtaaactggaccgtgaagagatcaagcctgtgatggcgctgggcctc
gtgcccatgtgctcctaccagatggagaggatgttcaacaccactcgcatcccagggaag
gacacagacgtgctccagcacctcccggacagcaggcacgtggccgtctaccacaagggc
cgatttttcaaggtgtggctctacgagggctcccgcctgctcaagcctcgggacctggag
atgcagttccagaggatcctggacgacccctccccaccccagcccggggaggagagactg
gcagccctcactgcagggggaagagtggagtgggcgcaggcacgccaggccttcttcagc
tctggcaagaacaaggctgccctggatgccatcgagcgcgctgcgttcttcgtggctctg
gacgaggagtctcaccactatgacccggaggacgaggccagcctcagcctctacggcaag
gccctgttgcacggcaactgctacaacaggtggttcgacaagtccttcacactcatctct
ttcaagaatggccagctgggactcaacacagagcacgcgtgggcagacgcccctatcata
gggcacctctgggagtttgtcctgggcaccgactccttccatctgggctacacagagacg
gggcactgtctgggcaaacccaaccctgtgctgcccccgcctcagcgactccagtgggac
attcctgagcagccctcaggccttctggacatgaccccggagtcctgctggagagctctg
cccccagctgacccctccgtgtcttggcagtgccaggcggtcatcgagagttcctaccag
gtggccaaggcgctggcggacgatgtggaactgtactgcttccagttcctgccctttggc
aaaggcctcatcaagaagtgccggaccagccctgacgccttcgtgcagatcgccctgcag
ctggcgcacttccgggacaggggcaagttctgcctgacctatgaagcctcaatgactaga
atgttccgagagggccggacagagacagtgcgctcctgcacccgcgagtccacagccttt
gtccaggccatggtgcaggggcgccacctgaacgaagacctccaacgtctgttccggaag
gctgctgagaagcaccagaatatgtaccgcctggccatgacaggggcggggattgacagg
cacctcttctgcctttatgtggtctccaagtacctgggagttgaatcccctttcctggct
gaggtgctctcagaaccctggcgcctctccactagccagatcgctcaattccagatccgt
atgttcgacccaaacaagtaccccaaacacctgggtgctggcggtggctttggccctgtg
gcagatgacggctacggcgtttcctacatgattgcgggtgagaacaccatcttcttccac
gtctccagcaagttctccagctcggagacgaatgcccagcgctttgggaaccagatccgc
caagctctgctagacatcgccaatcttttccaagttcccaaggctgatggctaa

DBGET integrated database retrieval system