KEGG   Bubalus bubalis (water buffalo): 102390392
Entry
102390392         CDS       T05912                                 

Gene name
PPARA
Definition
(RefSeq) peroxisome proliferator-activated receptor alpha
  KO
K07294  peroxisome proliferator-activated receptor alpha
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub03320  PPAR signaling pathway
bbub04024  cAMP signaling pathway
bbub04920  Adipocytokine signaling pathway
bbub04922  Glucagon signaling pathway
bbub04931  Insulin resistance
bbub04932  Non-alcoholic fatty liver disease
bbub05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    102390392 (PPARA)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102390392 (PPARA)
   04920 Adipocytokine signaling pathway
    102390392 (PPARA)
   03320 PPAR signaling pathway
    102390392 (PPARA)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102390392 (PPARA)
   04931 Insulin resistance
    102390392 (PPARA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102390392 (PPARA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbub03000]
    102390392 (PPARA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:bbub03310]
    102390392 (PPARA)
Transcription factors [BR:bbub03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    102390392 (PPARA)
Nuclear receptors [BR:bbub03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   102390392 (PPARA)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 102390392
NCBI-ProteinID: NP_001277840
UniProt: H9BTR1
LinkDB
Position
4
AA seq 470 aa
MEMVDTESPIGPLSPLEADDLESPLSADFLQEMGTIQEISQSTGEDSSGSFSFTEYQYLG
SGPGSDGSVITDTLSPASSPSSVSYPAVPGSAEESSTIALNIECRICGDKASGYHYGVYA
CEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPR
SEKAKLKAEILTCEHDLEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILAGKTNNNPP
FVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFA
NLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPK
FDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLKLHLQNNHPD
DVFLFPKLLQKMADLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggagatggtggacacagagagccccatcggtcccctctccccactggaggctgatgac
ctggaaagcccgctctcggcagacttcctacaagagatgggaaccattcaagagatttct
cagtctactggggaggacagttccggaagcttcagttttacagaataccagtacttagga
agtggtccaggatcagatggctccgttattacagacaccctgtcccccgcctcgagcccc
tcgtctgtctcctaccccgcggtccctggcagtgccgaggagtcatccaccatcgccctg
aacatcgagtgtaggatctgtggggacaaagcctctggctaccactacggtgtctacgcg
tgtgagggctgcaagggtttctttaggagaacgattcggctgaagctggtgtatgacaaa
tgtgaccgtagttgcaagattcagaaaaagaatcggaataagtgccaatactgtcgtttc
cacaagtgcctttcagtcgggatgtcccataacgcgattcgttttggacgaatgccaaga
tctgaaaaagcaaaattgaaggcagaaatccttacgtgtgagcatgacctagaagattcc
gaaaccgcggatctcaaatctctggccaagaggatatacgaggcctacttaaagaacttc
aacatgaacaaggtcaaggcccgggtcatccttgccgggaagaccaacaacaacccgcct
ttcgtcatccatgacatggagacgttgtgtatggccgagaagacgctggtggccaagctg
gtggccaacggcatccagaacaaggaggcggaagtccgcattttccactgctgccagtgc
acgtccgtggagaccgtcaccgagctcacggagtttgccaagtccatcccggggtttgca
aacttggacttgaatgaccaagtcactctgctgaagtatggagtttacgaagccatattt
gcgatgctgtcttctgtgatgaataaagacgggatgttggtagcctacgggaatggcttc
ataacccgtgaattccttaaaagcctaagaaaacccttctgtgatatcatggagcccaag
ttcgactttgcaatgaagttcaatgcactggagctggacgacagtgatatttccctcttt
gtggctgctatcatttgctgtggagatcggcctggcctcctaaacgtaggacacattgag
aaaatgcaggagggtattgtgcacgtgctcaaactccacctacagaacaaccatcctgac
gacgtcttcctcttcccaaaactcctgcaaaagatggcagacctgcggcagctggtcacg
gagcacgcacagctggtgcaggtgatcaagaagacggagtcggatgccgccctgcacccg
ctgctgcaggagatctacagggacatgtactga

DBGET integrated database retrieval system