KEGG   Bubalus bubalis (water buffalo): 102390395
Entry
102390395         CDS       T05912                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01522  Endocrine resistance
bbub04110  Cell cycle
bbub04137  Mitophagy - animal
bbub04218  Cellular senescence
bbub04934  Cushing syndrome
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05163  Human cytomegalovirus infection
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05169  Epstein-Barr virus infection
bbub05200  Pathways in cancer
bbub05206  MicroRNAs in cancer
bbub05212  Pancreatic cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102390395 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    102390395 (E2F1)
   04218 Cellular senescence
    102390395 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102390395 (E2F1)
   05206 MicroRNAs in cancer
    102390395 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102390395 (E2F1)
   05225 Hepatocellular carcinoma
    102390395 (E2F1)
   05226 Gastric cancer
    102390395 (E2F1)
   05214 Glioma
    102390395 (E2F1)
   05220 Chronic myeloid leukemia
    102390395 (E2F1)
   05218 Melanoma
    102390395 (E2F1)
   05219 Bladder cancer
    102390395 (E2F1)
   05215 Prostate cancer
    102390395 (E2F1)
   05224 Breast cancer
    102390395 (E2F1)
   05222 Small cell lung cancer
    102390395 (E2F1)
   05223 Non-small cell lung cancer
    102390395 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102390395 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102390395 (E2F1)
   05161 Hepatitis B
    102390395 (E2F1)
   05160 Hepatitis C
    102390395 (E2F1)
   05163 Human cytomegalovirus infection
    102390395 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102390395 (E2F1)
   05169 Epstein-Barr virus infection
    102390395 (E2F1)
   05165 Human papillomavirus infection
    102390395 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102390395 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbub03000]
    102390395 (E2F1)
Transcription factors [BR:bbub03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102390395 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 102390395
NCBI-ProteinID: XP_006075824
LinkDB
Position
14
AA seq 437 aa
MAVAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISTAQDASAPPAPAGPAAPAAGPRD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLNLETDHQYLAESSGPARGRGRHPGKGVK
SPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIHLI
AKKSKNHIQWLGSHATVGISGRLEGLTQDLQQLQESEQQLDHLLHICSTQLRLLSEDADS
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPE
ESVGGTSPGKTPSQGAASGEEDRTAELASAVPPPPPSPRSSPATDPSQSLLSLEQEPLLS
RMGGLRAPVDEDRLSPLVAADSLLEHVKEDFSGLLPEEFITLSPPHEALDYHFGLEEGEG
IRDLFDCDFGDLTPLDF
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggccgtggccggggcccccgcgggcggcccttgcgcgccggcgctggaggccctgctc
ggggccggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctccaccgcgcag
gacgccagcgccccgccggcccccgccggccccgccgcacccgccgccggcccccgggac
cctgacctgctgctcttcgccacgccgcaggcgccccggcccacacccagcgcgccgcgc
cccgcgctcggccgcccgccggtgaagcggaggctgaacctggaaactgaccatcaatac
ctggctgagagcagcgggccagctcggggcagaggccgccacccaggaaaaggtgtgaag
tccccaggggagaagtcacgctacgaaacatcgttgaacctgaccaccaaacgcttcttg
gagttactgagccgctcggctgatggagtggtcgacttgaactgggcggccgaggtgctg
aaggtgcagaaacgacgcatctacgacatcaccaacgtcctggagggcatccacctcatc
gcaaagaagtccaagaaccacatccagtggctaggcagccatgcaacggtggggatcagc
gggcggcttgaaggattgacccaggacctccagcaactgcaggagagtgagcagcagctg
gatcacctgctccacatctgcagcacccagctgcgtctgctctctgaggatgctgacagc
cagcgcctggcctatgtgacctgccaggaccttcgtagcatcgcagaccctgcagagcag
atggtcatggtgatcaaggccccccccgagacccagctccaagccgtggactcctcggag
aactttcagatctcccttaagagcaaacaaggccccatcgacgttttcctgtgccctgag
gagagtgtgggtggaaccagccctggaaagaccccgtcccagggggcagcttcgggggag
gaggacaggacagctgagcttgccagtgcggtgccgccaccaccaccatcaccccgctca
tcccctgccacggatcccagtcagtctctgctcagcctggagcaagaacctctgctttcc
cggatgggcggcctgcgggcccccgtggacgaggaccgcctatccccgctcgtggcggcc
gactcactcctggagcacgtgaaggaggacttctccggcctcctccccgaggagttcatc
accctgtcccccccccacgaggccctcgactaccactttggcctcgaggagggtgagggc
atcagagacctcttcgactgtgactttggggacctcactcccctggatttctga

KEGG   Bubalus bubalis (water buffalo): 102394305
Entry
102394305         CDS       T05912                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01522  Endocrine resistance
bbub04110  Cell cycle
bbub04218  Cellular senescence
bbub04934  Cushing syndrome
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05163  Human cytomegalovirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05169  Epstein-Barr virus infection
bbub05200  Pathways in cancer
bbub05206  MicroRNAs in cancer
bbub05212  Pancreatic cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102394305 (E2F3)
   04218 Cellular senescence
    102394305 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102394305 (E2F3)
   05206 MicroRNAs in cancer
    102394305 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102394305 (E2F3)
   05225 Hepatocellular carcinoma
    102394305 (E2F3)
   05226 Gastric cancer
    102394305 (E2F3)
   05214 Glioma
    102394305 (E2F3)
   05220 Chronic myeloid leukemia
    102394305 (E2F3)
   05218 Melanoma
    102394305 (E2F3)
   05219 Bladder cancer
    102394305 (E2F3)
   05215 Prostate cancer
    102394305 (E2F3)
   05224 Breast cancer
    102394305 (E2F3)
   05222 Small cell lung cancer
    102394305 (E2F3)
   05223 Non-small cell lung cancer
    102394305 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102394305 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102394305 (E2F3)
   05161 Hepatitis B
    102394305 (E2F3)
   05160 Hepatitis C
    102394305 (E2F3)
   05163 Human cytomegalovirus infection
    102394305 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102394305 (E2F3)
   05169 Epstein-Barr virus infection
    102394305 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102394305 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbub03000]
    102394305 (E2F3)
Transcription factors [BR:bbub03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102394305 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 102394305
NCBI-ProteinID: XP_006046596
LinkDB
Position
2
AA seq 461 aa
MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFPAAAAAPSAYIQILTT
NTSTTSCSSSLQSGAVAAGPLLPSAPGVEQTAGSLIYTTPHGPSGRAGLLQQPPALGRGG
SGGGGPPAKRRLELGESGQQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLG
LLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGC
SLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDI
RKISGLKDQTVIVVKAPPETRLEVPDPIESLQIHLASTQGPIEVYLCPEETETHSPMKTN
NQDHNGNIPKPTSKDLASTNSGHSDCSISMANLSPLASPANLLQQTEDQIPSNLEGPFVN
LLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgagaaaggggatccagcccgccctggagcagtacctggtgaccgccgggggtggggag
ggggcggctgtcgtcgctgcggccgctgcagcctccatggacaaaagggcactgctagcc
agccccggcttccccgccgccgccgccgccccgagcgcgtacatccagatcctcaccacg
aacacttccaccacctcctgttcctcctccctccaaagcggcgccgtcgccgccggcccc
ctcctccccagtgcccccggcgtggagcagaccgctggcagcctcatctacaccacgccg
cacggaccctccggcagagccgggctgctgcagcagccaccagcgctgggacgcggcggc
agcggcggcggcggccctccggcaaagcgcaggctggagctaggagaaagcggccagcag
tacctctcagatggtttaaaaacccccaagggcaaaggaagagctgcactccggagtcca
gacagcccaaaaactccaaaatctccctcagaaaaaacacggtatgatacatcccttggt
ctgctcaccaagaagttcattcagctcttgagccagtcacctgatggggtcttggatttg
aacaaggcagcagaggtgctgaaggtgcaaaagagaaggatttatgacatcaccaacgtc
ctggaaggcatccacctcattaagaagaagtctaaaaacaacgtgcagtggatgggctgc
agtctgtctgaggacgggggcatgctggcccagtgtcaaggcctgtcaaaagaagtgacc
gagctcagtcaggaagagaagaaattagatgaactgatccaaagctgcaccctggacctc
aaactgttaaccgaggattcagagaatcaaaggttagcttatgttacatatcaagatatt
cgaaaaattagtggccttaaagaccaaactgttatagttgtgaaagcccctccagaaaca
agacttgaagtgcctgacccaatagagagcctacaaatacatttggcaagtacccaagga
cccattgaggtttatttgtgtccagaagagactgaaacacacagtccaatgaaaacaaac
aaccaagaccacaatgggaatatccctaaacccacttccaaagacttggcttcaaccaac
tcaggacatagtgattgctcgatttctatggcaaacctttctcctctggcttccccggcc
aaccttttacagcagactgaggaccaaattccttccaacctagaaggaccatttgtgaac
ttactgcctcccctgctccaagaagactatctcctaagcctcggggaggaagaaggcatc
agcgatctctttgatgcttacgatttggaaaagctcccgttggtggaagactttatgtgt
agttga

KEGG   Bubalus bubalis (water buffalo): 102403332
Entry
102403332         CDS       T05912                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2
  KO
K09389  transcription factor E2F2
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01522  Endocrine resistance
bbub04110  Cell cycle
bbub04218  Cellular senescence
bbub04934  Cushing syndrome
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05163  Human cytomegalovirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05169  Epstein-Barr virus infection
bbub05200  Pathways in cancer
bbub05206  MicroRNAs in cancer
bbub05212  Pancreatic cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05222  Small cell lung cancer
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102403332 (E2F2)
   04218 Cellular senescence
    102403332 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102403332 (E2F2)
   05206 MicroRNAs in cancer
    102403332 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102403332 (E2F2)
   05225 Hepatocellular carcinoma
    102403332 (E2F2)
   05226 Gastric cancer
    102403332 (E2F2)
   05214 Glioma
    102403332 (E2F2)
   05220 Chronic myeloid leukemia
    102403332 (E2F2)
   05218 Melanoma
    102403332 (E2F2)
   05219 Bladder cancer
    102403332 (E2F2)
   05215 Prostate cancer
    102403332 (E2F2)
   05224 Breast cancer
    102403332 (E2F2)
   05222 Small cell lung cancer
    102403332 (E2F2)
   05223 Non-small cell lung cancer
    102403332 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102403332 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102403332 (E2F2)
   05161 Hepatitis B
    102403332 (E2F2)
   05160 Hepatitis C
    102403332 (E2F2)
   05163 Human cytomegalovirus infection
    102403332 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102403332 (E2F2)
   05169 Epstein-Barr virus infection
    102403332 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102403332 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbub03000]
    102403332 (E2F2)
Transcription factors [BR:bbub03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    102403332 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 102403332
NCBI-ProteinID: XP_025134532
LinkDB
Position
2
AA seq 437 aa
MLRGPRALAPAAGPPPKGLPAMSPTELWSPGLSSPQLCPTTTTYYTQLYPQTVPPAAAPG
TCLDATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGRPTVPEFRTPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGLFEDPTRPGKQQQLGQELKELMNMEQALDQLIHSCSLNFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRSEENLQIHLKSTQGPIEV
YLCPEEVQEPHSPAKELLPSTSALSPSPDSTQLSSNSDPGITEPTASSEPALTSPQVPPP
PPPPLVPLEATENMLELPHPLLQQTEDQFLSPTLPCSSPLISFSPPLDQDDYLWGLDGGE
GISDLFDTYDLGDLLIN
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgctgcgggggcctcgggccctggctccggcagccgggccacccccaaaggggctgccc
gcgatgagccccacggagctgtggtcgccgggcctcagcagcccccagctctgcccgacc
accaccacctactacacccagctgtacccgcagactgtgcctcccgctgcggcgcccggc
acctgcctcgacgccaccccccacggaccggagggtcaagctgtgcgatgcgtgccggct
ggccggctgccggccaaaaggaagctggacctggaggggatcgggaggcccacggtccct
gaattccggactcccaaggggaagtgcattagagtggatggcctccccagccccaaaacc
cccaagtcccccggagaaaagactcgctatgacacatcgctggggctgctcaccaagaaa
ttcatttacctcctgagtgagtctgaggatggggttctggacctaaactgggctgctgaa
gtgctggacgtgcagaagcggcgcatctacgacatcaccaacgtgctggagggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggactgtttgaagac
cccacacggcctgggaagcagcagcagctggggcaggagctgaaggagctgatgaacatg
gagcaggccctggaccagctcatccacagctgctctctgaacttcaagcacctgacagag
gacaaggccaacaagagactggcctacgtgacgtaccaggacatccgtgctgtgggcaac
tttaaggagcagacggtgattgcggtcaaggcccctccgcagacgagactggaggtgcct
gacaggagtgaggagaacctgcagatacatctgaagagcacacaggggcccatcgaggtt
tacctgtgcccagaagaggtgcaggagccccacagtcctgccaaggagctcctcccctcc
acttccgccctcagccccagccctgactccacccagctcagcagcaacagcgaccctggg
atcacggaacccacggcatcctcagagccagcactgacgtccccgcaggtcccgccgccg
cccccgccacccctcgtccccctggaggccacggagaacatgctggagctgccgcaccca
ctgctgcagcagacggaggaccagttcctgtccccgacgctgccctgcagctcccctctg
atcagcttctccccgcccttagaccaggatgactatctgtggggcctggacggcggggag
ggcatcagcgacctctttgacacctatgatctcggggacctgctgattaactga

DBGET integrated database retrieval system