KEGG   Bubalus bubalis (water buffalo): 102390834
Entry
102390834         CDS       T05912                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04068  FoxO signaling pathway
bbub04110  Cell cycle
bbub04310  Wnt signaling pathway
bbub04350  TGF-beta signaling pathway
bbub04371  Apelin signaling pathway
bbub04390  Hippo signaling pathway
bbub04520  Adherens junction
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04659  Th17 cell differentiation
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub05161  Hepatitis B
bbub05166  Human T-cell leukemia virus 1 infection
bbub05200  Pathways in cancer
bbub05210  Colorectal cancer
bbub05212  Pancreatic cancer
bbub05220  Chronic myeloid leukemia
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102390834 (SMAD4)
   04350 TGF-beta signaling pathway
    102390834 (SMAD4)
   04390 Hippo signaling pathway
    102390834 (SMAD4)
   04371 Apelin signaling pathway
    102390834 (SMAD4)
   04068 FoxO signaling pathway
    102390834 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102390834 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102390834 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    102390834 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102390834 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102390834 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102390834 (SMAD4)
   05212 Pancreatic cancer
    102390834 (SMAD4)
   05225 Hepatocellular carcinoma
    102390834 (SMAD4)
   05226 Gastric cancer
    102390834 (SMAD4)
   05220 Chronic myeloid leukemia
    102390834 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102390834 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102390834 (SMAD4)
   05161 Hepatitis B
    102390834 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 102390834
NCBI-ProteinID: NP_001277793
UniProt: W8P487
LinkDB
Position
22
AA seq 553 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGG
DRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAG
RAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIA
PAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEV
LHTMPIADPQPLD
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgccaaaagagcaatt
gaaagtttagttaaaaagctgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcaccctagcaagtgtgttaccatacagagaacattggatgga
aggcttcaggtggctggtcggaagggatttcctcatgtgatctatgcccgtctctggagg
tggcctgaccttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttggtgaaggat
gaatatgttcatgactttgagggacagccatcattatccactgaagggcattcaattcaa
accatccagcatccaccaagtaatcgtgcatcgacggagacatacagcaccccagctctc
ttagctccatctgagtctaatgctaccagcaccaccaattttcccaacattcctgtggct
tccacaagtcagcccgccagtatactggcaggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttat
catcataacagcactaccacctggacgggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatctccagcaccacccgcctatgccgccccatcccggacat
tactggccaccagttcacaatgagcttgcattccagcctcctatttctaatcatcctgct
cctgagtattggtgttccattgcttactttgagatggatgttcaagtaggagagacattt
aaggttccttcaagctgtcctattgttactgttgatggatatgtagacccttctggagga
gatcgcttttgcttgggtcaactctccaatgtccacaggacagaagccattgagagagca
aggttgcacataggcaaaggtgtgcagctggagtgtaaaggtgaaggtgatgtttgggtc
aggtgccttagcgaccacgcggtctttgtgcagagctactacctggacagagaagctggg
cgtgcacctggagatgctgttcataagatctacccaagtgcatatattaaggtctttgat
ttgcgtcagtgtcaccgtcagatgcagcagcaggcagccacggcacaagctgcagcagct
gcccaggcagcggccgtggcaggaaacatcccgggcccagggtcagtaggtggaatagcc
ccagccatcagtttgtcggctgccgccgggatcggtgtggatgacctccgtcgtttatgc
atactcaggatgagttttgtgaaaggctggggacctgattacccaagacagagcatcaag
gaaacaccttgttggattgagattcacttacaccgggccctccagctcctcgatgaagtc
cttcacaccatgcctattgccgacccacagcctttagactga

DBGET integrated database retrieval system